Record in detail


General Info

  • lamp_id:L03A000135
  • Name:HIS1_HUMAN
  • FullName:Histatin-1
  • Source:Homo sapiens
  • Mass:6962.9 Da
  • Sequence Length:57 aa
  • Isoelectric Point:9.47
  • Activity:Antimicrobial
  • Sequence
        MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
  • Function:Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000135    From 1 To 57 E-value: 4e-29 Score: 118
        MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
  • 2. L12A07823|    From 1 To 57 E-value: 2e-28 Score: 115
        MKFFVFALILALMISMTSADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
  • 3. L12A07822|    From 1 To 57 E-value: 7e-28 Score: 114
        MKFFVFALILALMISMTRADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
  • 4. L12A07821|    From 1 To 57 E-value: 1e-26 Score: 110
        MKFFVFALILALMISMTRADSHEKRHHGYRRKFHEKHHSHIEFPFYGDYGTNYLYDN
  • 5. L12A07819|    From 1 To 49 E-value: 1e-19 Score: 87
        MKFFVFALILALMISMTRADSHEKRHHEHRRKFHEKHHSHREYPFYGYY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Offner G.D.,Hyslop D.,Diamond R.D.,Yang Y.C.,Oppenheim F.G.,
  •   Title:The primary structure and functional characterization of the neutral histidine-rich polypeptide from human parotid secretion.
  •   Journal:J. Biol. Chem., 1986, 261, 1177-1182  [MEDLINE:86111755]
  •   [2]  Diamond R.D.,Levitz S.M.,McMillian F.M.,Xu T.,Oppenheim F.G.,
  •   Title:Histatins, a novel family of histidine-rich proteins in human parotid secretion. Isolation, characterization, primary structure, and fungistatic effects on Candida albicans.
  •   Journal:J. Biol. Chem., 1988, 263, 7472-7477  [MEDLINE:88227937]
  •   [3]  Azen E.A.,Sabatini L.M.,
  •   Title:Histatins, a family of salivary histidine-rich proteins, are encoded by at least two loci (HIS1 and HIS2).
  •   Journal:Biochem. Biophys. Res. Commun., 1989, 160, 495-502  [MEDLINE:89246491]
  •   [4]  Oppenheim F.G.,Milunsky A.,Skare J.C.,Wyandt H.E.,Vanderspek J.C.,
  •   Title:Localization of the genes for histatins to human chromosome 4q13 and tissue distribution of the mRNAs.
  •   Journal:Am. J. Hum. Genet., 1989, 45, 381-387  [MEDLINE:89371745]
  •   [5]  Ogata K.,Ogino T.,Sugiyama K.,
  •   Title:Rapid purification and characterization of histatins (histidine-rich polypeptides) from human whole saliva.
  •   Journal:Arch. Oral Biol., 1990, 35, 415-419  [MEDLINE:90321151]
  •   [6]  Chen Z.W.
  •   Title:Nucleotide sequence analysis of the human salivary protein genes HIS1 and HIS2, and evolution of the STATH/HIS gene family.
  •   Journal:Mol. Biol. Evol., 1993, 10, 497-511  [MEDLINE:93330039]
  •   [7]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [8]  Inzitari R.,Amado F.,Monteiro J.A.,Fanali C.,Cabras T.,
  •   Title:Tyrosine polysulfation of human salivary histatin 1. A post-translational modification specific of the submandibular gland.
  •   Journal:J. Proteome Res., 2007, 6, 2472-2480  [PubMed:17503797]
  •   [9]  Vitorino R.,Duarte J.A.,Domingues P.,Lobo M.J.,Amado F.,
  •   Title:Salivary peptidomics.
  •   Journal:Expert Rev. Proteomics, 2010, 7, 709-721  [PubMed:20973643]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: