Record in detail


General Info

  • lamp_id:L03A000145
  • Name:CHY1_PAGMA
  • FullName:Chrysophsin-1
  • Source:Pagrus major
  • Mass:7721.1 Da
  • Sequence Length:68 aa
  • Isoelectric Point:8.5
  • Activity:Antimicrobial
  • Sequence
        MKFTATFLMLFIFVLMVEPGECGWKKWFNRAKKVGKTVGGLAVDHYLGKQPELDKRAVDEDPSAIVFD
  • Function:Has antibacterial activity against Gram-positive bacteria B.subtilis ATCC 6633, L.garvieae ATCC 49156 and S.iniae F-8502, and Gram-negative bacteria E.coli WT-2, V.anguillarum ATCC 19264, V.penaeicida KHA, V.harveyi ATCC 14126, V.vulnificus ATCC 33148, A.salmonicida NCMB 1102 and P.putida ATCC 12633. Has hemolytic activity against human red blood cells. Seems to disrupt the membranes by adopting an alpha helical conformation. May play a significant role in innate host defense.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000145    From 1 To 68 E-value: 4e-36 Score: 141
        MKFTATFLMLFIFVLMVEPGECGWKKWFNRAKKVGKTVGGLAVDHYLGKQPELDKRAVDEDPSAIVFD
  • 2. L03A000146    From 1 To 68 E-value: 7e-32 Score: 127
        MKFTATFLMLFIFVLMVEPGECGWKSVFRKAKKVGKTVGGLALDHYLGEQQELDKRAVDEDPSAIVFD
  • 3. L03A000141    From 1 To 66 E-value: 1e-24 Score: 103
        MKFTANFLMLFIFVLMFEPGECGWRTLLKKAEV--KTVGKLALKHYLGKQPELDKRAIDDDPSIIVFD
  • 4. L12A07889|    From 1 To 68 E-value: 2e-24 Score: 102
        MKFTATFLMMFIFVLMVEPGECGWGSIFKHGRHAAKHIGHAAVNHYLGEQQDLDKRAVDEDPNVIVFE
  • 5. L12A07888|    From 1 To 68 E-value: 8e-24 Score: 100
        MKFTATFLMMAIFVLMVEPGECGWGSFFKKAAHVGKHVGKAALTHYLGDKQELNKRAVDEDPNVIVFE

Structure

  •   Domains
  •   1  Name:Antimicrobial12    Interpro Link:IPR012515
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Uematsu K.,Morita Y.,Emoto Y.,Tanimoto N.,Iijima N.,
  •   Title:Purification and characterization of three isoforms of chrysophsin, a novel antimicrobial peptide in the gills of the red sea bream, Chrysophrys major.
  •   Journal:Eur. J. Biochem., 2003, 270, 675-686  [MEDLINE:22469439]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: