Record in detail


General Info

  • lamp_id:L03A000149
  • Name:AFP_ASPGI
  • FullName:Antifungal protein
  • Source:Aspergillus giganteus
  • Mass:9993.5 Da
  • Sequence Length:94 aa
  • Isoelectric Point:8.74
  • Activity:Antimicrobial
  • Sequence
        MKFVSLASLGFALVAALGAVATPVEADSLTAGGLDARDESAVLATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
  • Function:This protein inhibits the growth of a variety of fungal species.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000149    From 1 To 94 E-value: 0 Score: 187
        MKFVSLASLGFALVAALGAVATPVEADSLTAGGLDARDESAVLATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
  • 2. L02A000148    From 1 To 51 E-value: 9e-25 Score: 103
        ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
  • 3. L01A002663    From 2 To 51 E-value: 2e-24 Score: 102
        TYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
  • 4. L13A028663    From 1 To 50 E-value: 3e-24 Score: 102
        ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCY
  • 5. L02A001559    From 1 To 51 E-value: 2e-23 Score: 99.8
        ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYC

Structure

  •   Domains
  •   1  Name:Antifungal-protein_domain    Interpro Link:IPR023112
  •   2  Name:Antifungal_prot    Interpro Link:IPR022706
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kolckenbrock H.,Nakamura Y.,Okahashi I.,Omata K.,Nakaya K.,
  •   Title:Amino acid sequence and disulfide bridges of an antifungal protein isolated from Aspergillus giganteus.
  •   Journal:Eur. J. Biochem., 1990, 193, 31-38  [MEDLINE:91031461]
  •   [2]  Stahl U.,Ulbrich N.,Wnendt S.,
  •   Title:Cloning and nucleotide sequence of a cDNA encoding the antifungal-protein of Aspergillus giganteus and preliminary characterization of the native gene.
  •   Journal:Nucleic Acids Res., 1990, 18, 3987-3987  [MEDLINE:90326523]
  •   [3]  Stahl U.,Ulbrich N.,Wnendt S.,
  •   Title:Molecular cloning, sequence analysis and expression of the gene encoding an antifungal-protein from Aspergillus giganteus.
  •   Journal:Curr. Genet., 1994, 25, 519-523  [MEDLINE:94363778]
  •   [4]  Martinez del Pozo A.,Lacadena J.,Santoro J.,Bruix M.,Campos-Olivas R.,
  •   Title:NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism.
  •   Journal:Biochemistry, 1995, 34, 3009-3021  [MEDLINE:95200923]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: