Record in detail


General Info

  • lamp_id:L03A000154
  • Name:DFAR2_MOUSE
  • FullName:Alpha-defensin-related sequence 2
  • Source:Mus musculus
  • Mass:9979.4 Da
  • Sequence Length:91 aa
  • Isoelectric Point:7.91
  • Activity:Antimicrobial
  • Sequence
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQPGEKDQAVSVSFGDPQGSALQDAALGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
  • Function:Apparent precursor of a secreted, cationic, proline- and cysteine-rich peptide that contains Cys-Pro-Xaa repeats. Unlike cryptdin, the proposed mature peptide region lacks the structural motif characteristic of defensins. It may have microbicidal activities.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P17534
  •   2  Database:AMD  DEFY_MOUSE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000154    From 1 To 91 E-value: 0 Score: 184
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQPGEKDQAVSVSFGDPQGSALQDAALGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
  • 2. L03A000157    From 1 To 91 E-value: 2e-37 Score: 145
        MKKLVLLSAFVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSISFGDPEGYALQDAAIRRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
  • 3. L03A000158    From 1 To 91 E-value: 3e-32 Score: 129
        MKKLVLLSAFVLLAFQVQADSIQNTDEETKTEEQPGEENQAMSVSFGDPEGSALQDAAVGMARPCPPCPSCPSCPWCPMCPRCPSCKCNPK
  • 4. L03A000155    From 1 To 92 E-value: 2e-26 Score: 109
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQQGEEDQAVSVSFGDPQGSGLQDAAALGWGRRCPRCPPCPRCSWCPRCPTCPRCNCNPK
  • 5. L03A000003    From 1 To 51 E-value: 2e-20 Score: 89.7
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESL

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lauldi J.C.,Ouellette A.J.,
  •   Title:
  •   Journal:J. Biol. Chem., 1994, 269, 18702-18702  [MEDLINE:94308115]
  •   [2]  Lauldi J.C.,Ouellette A.J.,
  •   Title:A novel mouse gene family coding for cationic, cysteine-rich peptides. Regulation in small intestine and cells of myeloid origin.
  •   Journal:J. Biol. Chem., 1990, 265, 9831-9837  [MEDLINE:90277674]
  •   [3]  Ouellette A.J.,Huttner K.M.,
  •   Title:A family of defensin-like genes codes for diverse cysteine-rich peptides in mouse Paneth cells.
  •   Journal:Genomics, 1994, 24, 99-109  [MEDLINE:95203896]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: