Record in detail


General Info

  • lamp_id:L03A000155
  • Name:DFAR7_MOUSE
  • FullName:Alpha-defensin-related sequence 7
  • Source:Mus musculus
  • Mass:10126.5 Da
  • Sequence Length:92 aa
  • Isoelectric Point:5.03
  • Activity:Antimicrobial
  • Sequence
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQQGEEDQAVSVSFGDPQGSGLQDAAALGWGRRCPRCPPCPRCSWCPRCPTCPRCNCNPK
  • Function:Apparent precursor of a secreted, cationic, proline- and cysteine-rich peptide that contains Cys-Pro-Xaa repeats. Unlike cryptdin, the proposed mature peptide region lacks the structural motif characteristic of defensins. It may have microbicidal activities.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P50715
  •   2  Database:AMD  DEFW_MOUSE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000155    From 1 To 92 E-value: 0 Score: 188
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQQGEEDQAVSVSFGDPQGSGLQDAAALGWGRRCPRCPPCPRCSWCPRCPTCPRCNCNPK
  • 2. L03A000157    From 1 To 91 E-value: 5e-34 Score: 134
        MKKLVLLSAFVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSISFGDPEGYALQD-AAIRRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
  • 3. L03A000158    From 1 To 91 E-value: 2e-28 Score: 115
        MKKLVLLSAFVLLAFQVQADSIQNTDEETKTEEQPGEENQAMSVSFGDPEGSALQD-AAVGMARPCPPCPSCPSCPWCPMCPRCPSCKCNPK
  • 4. L03A000154    From 1 To 91 E-value: 2e-22 Score: 96.3
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQPGEKDQAVSVSFGDPQGSALQD-AALGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
  • 5. L03A000004    From 1 To 50 E-value: 8e-19 Score: 84
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEES

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ouellette A.J.,Huttner K.M.,
  •   Title:A family of defensin-like genes codes for diverse cysteine-rich peptides in mouse Paneth cells.
  •   Journal:Genomics, 1994, 24, 99-109  [MEDLINE:95203896]
  •   [2]  Andersson M.,Refai E.,Karlsson J.,Putsep K.,Hornef M.W.,
  •   Title:Increased diversity of intestinal antimicrobial peptides by covalent dimer formation.
  •   Journal:Nat. Immunol., 2004, 5, 836-843  [PubMed:15235601]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: