Record in detail


General Info

  • lamp_id:L03A000156
  • Name:DEFA1_MOUSE
  • FullName:Alpha-defensin 1
  • Source:Mus musculus
  • Mass:10460.8 Da
  • Sequence Length:93 aa
  • Isoelectric Point:4.86
  • Activity:Antimicrobial
  • Sequence
        MKKLVLLFALVLLGFQVQADSIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYTLCCR
  • Function:Probably contributes to the antimicrobial barrier function of the small bowel mucosa. Has antibacterial activity against attenuated mutants of S.typhimurium.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000156    From 1 To 93 E-value: 0 Score: 191
        MKKLVLLFALVLLGFQVQADSIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYTLCCR
  • 2. L03A000004    From 1 To 85 E-value: 9.80909e-45 Score: 169
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYMLCCR
  • 3. L03A000178    From 1 To 93 E-value: 1.00053e-42 Score: 163
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLMYTLCCR
  • 4. L03A000003    From 1 To 85 E-value: 1.00053e-42 Score: 163
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMHTLCCR
  • 5. L03A000177    From 1 To 93 E-value: 6.99949e-42 Score: 160
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRARGCKGRERMNGTCRKGHLLYMLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Naftilan J.,Frederick D.,James M.,Greco R.M.,Ouellette A.J.,
  •   Title:Developmental regulation of cryptdin, a corticostatin/defensin precursor mRNA in mouse small intestinal crypt epithelium.
  •   Journal:J. Cell Biol., 1989, 108, 1687-1695  [MEDLINE:89234158]
  •   [2]  Lauldi J.C.,Ouellette A.J.,
  •   Title:A novel mouse gene family coding for cationic, cysteine-rich peptides. Regulation in small intestine and cells of myeloid origin.
  •   Journal:J. Biol. Chem., 1990, 265, 9831-9837  [MEDLINE:90277674]
  •   [3]  Ouellette A.J.,Henschen A.H.,Miller S.I.,Selsted M.E.,
  •   Title:Enteric defensins: antibiotic peptide components of intestinal host defense.
  •   Journal:J. Cell Biol., 1992, 118, 929-936  [MEDLINE:92363933]
  •   [4]  Selsted M.E.,Henschen A.H.,Miller S.I.,Ouellette A.J.,
  •   Title:Purification and primary structure of murine cryptdin-1, a Paneth cell defensin.
  •   Journal:FEBS Lett., 1992, 304, 146-148  [MEDLINE:92316217]
  •   [5]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: