Record in detail


General Info

  • lamp_id:L03A000157
  • Name:DAR12_MOUSE
  • FullName:Alpha-defensin-related sequence 12
  • Source:Mus musculus
  • Mass:10145.7 Da
  • Sequence Length:91 aa
  • Isoelectric Point:6.32
  • Activity:Antimicrobial
  • Sequence
        MKKLVLLSAFVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSISFGDPEGYALQDAAIRRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
  • Function:Apparent precursor of a secreted, cationic, proline- and cysteine-rich peptide that contains Cys-Pro-Xaa repeats. Unlike cryptdin, the proposed mature peptide region lacks the structural motif characteristic of defensins. It may have microbicidal activities (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P50716
  •   2  Database:AMD  DEFV_MOUSE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000157    From 1 To 91 E-value: 0 Score: 186
        MKKLVLLSAFVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSISFGDPEGYALQDAAIRRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
  • 2. L03A000158    From 1 To 91 E-value: 5e-32 Score: 128
        MKKLVLLSAFVLLAFQVQADSIQNTDEETKTEEQPGEENQAMSVSFGDPEGSALQDAAVGMARPCPPCPSCPSCPWCPMCPRCPSCKCNPK
  • 3. L03A000155    From 1 To 92 E-value: 6e-22 Score: 94.7
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQQGEEDQAVSVSFGDPQGSGLQDAAALGWGRRCPRCPPCPRCSWCPRCPTCPRCNCNPK
  • 4. L03A000154    From 1 To 91 E-value: 5e-21 Score: 91.3
        MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQPGEKDQAVSVSFGDPQGSALQDAALGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
  • 5. L03A000004    From 1 To 52 E-value: 9e-20 Score: 87.4
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ouellette A.J.,Huttner K.M.,
  •   Title:A family of defensin-like genes codes for diverse cysteine-rich peptides in mouse Paneth cells.
  •   Journal:Genomics, 1994, 24, 99-109  [MEDLINE:95203896]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: