Record in detail


General Info

  • lamp_id:L03A000161
  • Name:TACA2_TACTR
  • FullName:Tachystatin-A2
  • Source:Tachypleus tridentatus
  • Mass:7494.9 Da
  • Sequence Length:67 aa
  • Isoelectric Point:8.92
  • Activity:Antimicrobial
  • Sequence
        MKLQNTLILIGCLFLMGAMIGDAYSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
  • Function:Exhibits stronger antimicrobial activity against the Gram-positive bacteria (S.aureus (IC(50) is 4.2 ug/ml)) and fungi (C.albicans (IC(50) is 3.0 ug/ml) and P.pastoris (IC(50) is 0.5 ug/ml)) than Gram-negative bacteria (E.coli (IC(50) is 25 ug/ml)). Binds to chitin (8.4 uM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q9U8X3
  •   2  Database:AMD  TACA1_TACTR

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000161    From 1 To 67 E-value: 1e-34 Score: 136
        MKLQNTLILIGCLFLMGAMIGDAYSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
  • 2. L12A08087|    From 1 To 67 E-value: 3e-34 Score: 135
        MKLQNTLILIGCLFLMGAMIGDAYSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
  • 3. L01A002992    From 1 To 44 E-value: 4e-21 Score: 91.7
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
  • 4. L01A002892    From 1 To 44 E-value: 8e-21 Score: 90.5
        YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
  • 5. L13A023384    From 1 To 39 E-value: 2e-16 Score: 76.6
        YSRCQLQGFNCVVRSYGLPTIPCCRG----SYFPGSTYGRCQR

Structure

  •   Domains
  •   1  Name:Antimicrobial_tachystatin_A    Interpro Link:IPR022717
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Iwanaga S.,Hirata M.,Nagayama R.,Omotezako M.,Osaki T.,
  •   Title:Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
  •   Journal:J. Biol. Chem., 1999, 274, 26172-26178  [MEDLINE:99403058]
  •   [2]  Demura M.,Kumaki Y.,Osaki T.,Kawabata S.,Fujitani N.,
  •   Title:Structure of the antimicrobial peptide tachystatin A.
  •   Journal:J. Biol. Chem., 2002, 277, 23651-23657  [PubMed:11959852]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: