Record in detail


General Info

  • lamp_id:L03A000163
  • Name:DEFI_TENMO
  • FullName:Tenecin-1
  • Source:Tenebrio molitor
  • Mass:9175.7 Da
  • Sequence Length:84 aa
  • Isoelectric Point:8.04
  • Activity:Antimicrobial
  • Sequence
        MKLTIFALVACFFILQIAAFPLEEAATAEEIEQGEHIRVKRVTCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR
  • Function:Bactericidal protein produced in response to injury. It is cytotoxic to Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000163    From 1 To 84 E-value: 9.80909e-45 Score: 169
        MKLTIFALVACFFILQIAAFPLEEAATAEEIEQGEHIRVKRVTCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR
  • 2. L03A000130    From 1 To 83 E-value: 2e-22 Score: 96.3
        MKFFITFTFVLSLVVLTVYSAP-REFAEPEEQDEG-HFRVKRFTCDVLSVEAKGVKLNHAACGIHCLFRRRTGGYCNKKRVCICR
  • 3. L01A000291    From 1 To 43 E-value: 1e-20 Score: 90.1
        VTCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR
  • 4. L12A12243|    From 1 To 64 E-value: 6e-20 Score: 87.8
        YPLDQVEEQDE-HQVAHIRVRRVTCDLLSAEAKGVKVNHAACAAHCLLKRKRGGYCNKRRICVCR
  • 5. L01A002994    From 2 To 43 E-value: 6e-16 Score: 74.3
        TCDVLSVEAKGVKLNHAACGIHCLFRRRTGGYCNKKRVCICR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lee B.L.,Natori S.,Kurata S.,Lee S.Y.,Moon H.J.,
  •   Title:Purification and molecular cloning of cDNA for an inducible antibacterial protein from larvae of the coleopteran, Tenebrio molitor.
  •   Journal:J. Biochem., 1994, 116, 53-58  [MEDLINE:95096025]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: