Record in detail


General Info

  • lamp_id:L03A000165
  • Name:DEFA2_MOUSE
  • FullName:Alpha-defensin 2
  • Source:Mus musculus
  • Mass:10559.9 Da
  • Sequence Length:93 aa
  • Isoelectric Point:5.18
  • Activity:Antimicrobial
  • Sequence
        MKPLVLLSALVLLSFQVQADPIQNTDEETKTEEQSGEEDQAVSVSFGDREGASLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR
  • Function:Has broad-spectrum antimicrobial properties. Has antibacterial activity against the Gram-positive bacterium L.monocytogenes EGD and the Gram-negative bacteria E.coli ML-35p and avirulent S.typhimurium 7953, but not against the mouse-virulent S.typhimurium 14028S. Probably contributes to the antimicrobial barrier function of the small bowel mucosa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000165    From 1 To 93 E-value: 0 Score: 191
        MKPLVLLSALVLLSFQVQADPIQNTDEETKTEEQSGEEDQAVSVSFGDREGASLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR
  • 2. L03A000003    From 1 To 85 E-value: 2.00386e-43 Score: 165
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMHTLCCR
  • 3. L03A000004    From 1 To 85 E-value: 8.00001e-42 Score: 160
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYMLCCR
  • 4. L12A08327|    From 1 To 93 E-value: 5.99994e-41 Score: 157
        MKTLVLLSALILLAFQVQADPIQNTDEETKTEEQPGKEDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLIYTLCCR
  • 5. L03A000176    From 1 To 93 E-value: 7.00005e-41 Score: 157
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRREHMNGTCRKGHLMYTLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Harwig S.S.S.L.,Eisenhauer P.B.,
  •   Title:Cryptdins: antimicrobial defensins of the murine small intestine.
  •   Journal:Infect. Immun., 1992, 60, 3556-3565  [PubMed:1500163]
  •   [2]  Ouellette A.J.,Henschen A.H.,Miller S.I.,Selsted M.E.,
  •   Title:Enteric defensins: antibiotic peptide components of intestinal host defense.
  •   Journal:J. Cell Biol., 1992, 118, 929-936  [MEDLINE:92363933]
  •   [3]  Takahashi N.,Hagen M.D.,Horton J.H.,Wang X.,Ko M.S.,
  •   Title:Genetic mapping of 40 cDNA clones on the mouse genome by PCR.
  •   Journal:Mamm. Genome, 1994, 5, 349-355  [MEDLINE:94319082]
  •   [4]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: