Record in detail


General Info

  • lamp_id:L03A000167
  • Name:SAPE_SARPE
  • FullName:Sapecin
  • Source:Sarcophaga peregrina
  • Mass:9914.4 Da
  • Sequence Length:94 aa
  • Isoelectric Point:8.5
  • Activity:Antimicrobial
  • Sequence
        MKSFIVLAVTLCLAAFFMGQSVASPAAAAEESKFVDGLHALKTIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN
  • Function:Sapecins, which are potent bactericidal proteins, are produced in response to injury. Sapecin is cytotoxic to Gram-positive bacteria, and to a lesser extent against Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000167    From 1 To 94 E-value: 0 Score: 192
        MKSFIVLAVTLCLAAFFMGQSVASPAAAAEESKFVDGLHALKTIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN
  • 2. L03A000131    From 1 To 94 E-value: 2e-40 Score: 155
        MKFFMVFVVTFCLAVCFVSQSLAIPADAANDAHFVDGVQALKEIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN
  • 3. L03A000132    From 1 To 96 E-value: 8e-26 Score: 107
        MKFFSLFPVILVVVACLTMRANAAPSAGDEVDHHPDYVDGVEALRQLEPELHGRYKRATCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCR
  • 4. L01A002961    From 1 To 40 E-value: 9e-19 Score: 84
        ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN
  • 5. L02A000216    From 1 To 40 E-value: 3e-18 Score: 82.4
        ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN

Structure

  •   Domains
  •   1  Name:Defensin_insect    Interpro Link:IPR017982
  •   2  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Natori S.,Matsuyama K.,
  •   Title:Molecular cloning of cDNA for sapecin and unique expression of the sapecin gene during the development of Sarcophaga peregrina.
  •   Journal:J. Biol. Chem., 1988, 263, 17117-17121  [MEDLINE:89034216]
  •   [2]  Natori S.,Matsuyama K.,
  •   Title:Purification of three antibacterial proteins from the culture medium of NIH-Sape-4, an embryonic cell line of Sarcophaga peregrina.
  •   Journal:J. Biol. Chem., 1988, 263, 17112-17116  [MEDLINE:89034215]
  •   [3]  Kohda D.,Komano H.,Kuzuhara T.,Shimada I.,Hanzawa H.,
  •   Title:1H nuclear magnetic resonance study of the solution conformation of an antibacterial protein, sapecin.
  •   Journal:FEBS Lett., 1990, 269, 413-420  [MEDLINE:90382590]
  •   [4]  Natori S.,Matsuyama K.,Nakajima Y.,Kuzuhara T.,
  •   Title:Determination of the disulfide array in sapecin, an antibacterial peptide of Sarcophaga peregrina (flesh fly).
  •   Journal:J. Biochem., 1990, 107, 514-518  [MEDLINE:90292974]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: