Record in detail


General Info

  • lamp_id:L03A000177
  • Name:DEFA6_MOUSE
  • FullName:Alpha-defensin 6/12
  • Source:Mus musculus
  • Mass:10425.8 Da
  • Sequence Length:93 aa
  • Isoelectric Point:4.65
  • Activity:Antimicrobial
  • Sequence
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRARGCKGRERMNGTCRKGHLLYMLCCR
  • Function:Has broad-spectrum antimicrobial properties. Has antibacterial activity against the Gram-positive bacterium L.monocytogenes EGD and the Gram-negative bacteria E.coli ML-35p and avirulent S.typhimurium 7953, but not against the mouse-virulent S.typhimurium 14028S. Probably contributes to the antimicrobial barrier function of the small bowel mucosa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000177    From 1 To 93 E-value: 0 Score: 192
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRARGCKGRERMNGTCRKGHLLYMLCCR
  • 2. L03A000004    From 1 To 85 E-value: 0 Score: 176
        ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYMLCCR
  • 3. L12A08317|    From 1 To 93 E-value: 4.06377e-44 Score: 167
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGASLQEESLRDLVCYCRARGCKGRERMNGTCSKGHLLYMLCCR
  • 4. L03A000178    From 1 To 93 E-value: 4.06377e-44 Score: 167
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLMYTLCCR
  • 5. L03A000003    From 1 To 85 E-value: 2.00386e-43 Score: 165
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMHTLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Harwig S.S.S.L.,Eisenhauer P.B.,
  •   Title:Cryptdins: antimicrobial defensins of the murine small intestine.
  •   Journal:Infect. Immun., 1992, 60, 3556-3565  [PubMed:1500163]
  •   [2]  Huttner K.M.,Cano-Gauci D.F.,Nosek M.T.,Hsieh M.M.,Ouellette A.J.,
  •   Title:Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.
  •   Journal:Infect. Immun., 1994, 62, 5040-5047  [MEDLINE:95012724]
  •   [3]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: