Record in detail


General Info

  • lamp_id:L03A000182
  • Name:DEFA3_MOUSE
  • FullName:Alpha-defensin 3
  • Source:Mus musculus
  • Mass:10527.9 Da
  • Sequence Length:93 aa
  • Isoelectric Point:5.17
  • Activity:Antimicrobial
  • Sequence
        MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRRERMNGTCRKGHLMYTLCCR
  • Function:Probably contributes to the antimicrobial barrier function of the small bowel mucosa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000182    From 1 To 93 E-value: 0 Score: 192
        MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRRERMNGTCRKGHLMYTLCCR
  • 2. L12A11495|    From 1 To 89 E-value: 0 Score: 184
        TLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRRERMNGTCRKGHLMYTLC
  • 3. L03A000003    From 1 To 85 E-value: 0 Score: 174
        ALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLMHTLCCR
  • 4. L03A000067    From 1 To 81 E-value: 2.94273e-44 Score: 168
        LAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRREHMNGTCRKGHLMYTLCCR
  • 5. L03A000176    From 1 To 93 E-value: 4.06377e-44 Score: 167
        MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRREHMNGTCRKGHLMYTLCCR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ouellette A.J.,Henschen A.H.,Miller S.I.,Selsted M.E.,
  •   Title:Enteric defensins: antibiotic peptide components of intestinal host defense.
  •   Journal:J. Cell Biol., 1992, 118, 929-936  [MEDLINE:92363933]
  •   [2]  Ouellette A.J.,Selsted M.E.,Huttner K.M.,
  •   Title:Structure and diversity of the murine cryptdin gene family.
  •   Journal:Genomics, 1994, 19, 448-453  [MEDLINE:94245232]
  •   [3]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: