Record in detail


General Info

  • lamp_id:L03A000193
  • Name:ANDP_DROME
  • FullName:Andropin
  • Source:Drosophila melanogaster
  • Mass:6151.3 Da
  • Sequence Length:57 aa
  • Isoelectric Point:7.54
  • Activity:Antimicrobial
  • Sequence
        MKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
  • Function:Male-specific peptide with moderate activity against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000193    From 1 To 57 E-value: 4e-27 Score: 111
        MKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
  • 2. L03A000190    From 1 To 56 E-value: 9e-17 Score: 77.4
        MKYFSVLVVLTLILAISVGQSNAIFVDVLDNVETALHNAAKAGFKLIKPIEKMIMP
  • 3. L03A000194    From 1 To 57 E-value: 0.000000000000007 Score: 70.9
        MKYFVVLVVLALILAITVDPSDAVFIDILDKMENAIHKAAQAGIGLAKPIENMILPK
  • 4. L03A000192    From 1 To 57 E-value: 0.000000000000008 Score: 70.9
        MKYFVVLVVLALILAIAVGPSDAVFIDILDKMENAIHKAAQAGIGIAKPIENMILPK
  • 5. L01A002903    From 1 To 34 E-value: 0.00000000000001 Score: 70.5
        VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hultmark D.,Engstroem A.,Kimbrell D.A.,Kylsten P.,Samakovlis C.,
  •   Title:The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster.
  •   Journal:EMBO J., 1991, 10, 163-169  [MEDLINE:91114699]
  •   [2]  Wang L.,Clark A.G.,
  •   Title:Molecular population genetics of Drosophila immune system genes.
  •   Journal:Genetics, 1997, 147, 713-724  [MEDLINE:97476321]
  •   [3]  Aguade M.,Ramos-Onsins S.,
  •   Title:Molecular evolution of the Cecropin multigene family in Drosophila: functional genes vs pseudogenes.
  •   Journal:Genetics, 1998, 150, 157-171  [MEDLINE:98393576]
  •   [4]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [5]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]
  •   [6]  Chigusa S.I.,Sawai H.,Kasahara K.,Date-Ito A.,
  •   Title:Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.
  •   Journal:J. Mol. Evol., 2002, 54, 665-670  [MEDLINE:21962106]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: