Record in detail

lamp_id:L03A000196
Name:PYY2_BOVIN
FullName:Caltrin
Source:Bos taurus
Mass:8976.4 Da
Sequence Length:80 aa
Isoelectric Point:10.92
Activity:Antimicrobial
Sequence
MMAGRRSWPAMATVLLALLVCLGELVDSKPQPSDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
Function:Inhibits calcium transport into spermatozoa; it does not bind directly to calcium. Binds to calmodulin. Inhibits the growth of microorganisms. Seem to act as an antibiotic by permeabilizing the bacterial membrane.

Top similar AMPs on LAMP
1. L03A000196 From 1 To 80 E-value: 2.99878e-43 Score: 165
MMAGRRSWPAMATVLLALLVCLGELVDSKPQPSDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
2. L01A000335 From 1 To 48 E-value: 1e-23 Score: 100
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
3. L02A000234 From 1 To 47 E-value: 4e-23 Score: 98.6
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV
4. L01A000056 From 1 To 35 E-value: 0.0000000000005 Score: 65.1
SDEKASPDRHHRFSLSRYAKLANRL----------SKWIGNRGNR
5. L13A022822 From 1 To 27 E-value: 0.0000000002 Score: 56.2
SLSRYAKLANRLANPKLLETFLSKWIG

Reference
[1] Scheit K.H.,Theil R.,
Title:Amino acid sequence of seminalplasmin, an antimicrobial protein from bull semen.
Journal:EMBO J., 1983, 2, 1159-1163 [PubMed:16453469]
[2] Lardy H.A.,Kruggel W.,San Agustin J.,Lewis R.V.,
Title:The structure of caltrin, the calcium-transport inhibitor of bovine seminal plasma.
Journal:Proc. Natl. Acad. Sci. U.S.A., 1985, 82, 6490-6491 [MEDLINE:86016727]
[3] Bhargava P.M.,Kumari V.K.,Sitaram N.,
Title:Seminalplasmin and caltrin are the same protein.
Journal:FEBS Lett., 1986, 201, 233-236 [MEDLINE:86220812]
[4] Scheit K.H.,Freudenstein J.,Wagner S.,
Title:Characterization by cDNA cloning of the mRNA for seminalplasmin, the major basic protein of bull semen.
Journal:DNA Cell Biol., 1990, 9, 437-442 [MEDLINE:91000358]
[5] Scheit K.H.,Preuss K.D.,Krauhs E.,
Title:Functional properties of peptides derived from seminalplasmin: binding to monospecific anti-seminalplasmin immunoglobulins G and calmodulin.
Journal:Biol. Chem. Hoppe-Seyler, 1990, 371, 111-115 [MEDLINE:90241472]
[6] Scheit K.K.,Kleine Kuhlmann J.,
Title:Characterization of the gene for seminalplasmin, a secretory protein of the bovine seminal vesicle.
Journal:Biochim. Biophys. Acta, 1993, 1173, 85-86 [MEDLINE:93250053]
[7] Nagaraj R.,Sitaram N.,
Title:Seminal plasmin.
Journal:Bioessays, 1995, 17, 415-422 [MEDLINE:95305850]