Record in detail


General Info

  • lamp_id:L03A000198
  • Name:CECB_BOMMO
  • FullName:Cecropin-B
  • Source:Bombyx mori
  • Mass:6831.2 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.23
  • Activity:Antimicrobial
  • Sequence
        MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000198    From 1 To 63 E-value: 5e-31 Score: 124
        MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK
  • 2. L12A08520|    From 1 To 63 E-value: 7e-31 Score: 124
        MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAVGK
  • 3. L12A08521|    From 1 To 63 E-value: 8e-30 Score: 120
        MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGWNIRDGIVKAGPAIEVLGSAKAVGK
  • 4. L12A04776|    From 1 To 58 E-value: 3e-25 Score: 105
        ILSFVFACLLALSAVSAAPEPRWKVFKKIEKMGRNIRDGIVKAGPAIEVLGSAKALGK
  • 5. L12A07884|    From 1 To 63 E-value: 3e-25 Score: 105
        MKFSRVFLFVFACLVALSAVSAAPEPRWKVFKKIEKMGRNIRDGIVKAGPAIEVLGSAKALGK

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Shiba T.,Nakai T.,Ueki Y.,Teshima T.,
  •   Title:Structure determination of lepidopteran, self-defense substance produced by silkworm.
  •   Journal:Tetrahedron, 1986, 42, 829-834  [:]
  •   [2]  Hirano H.,Ueno T.,Suginaka S.,Morishima I.,
  •   Title:Isolation and structure of cecropins, inducible antibacterial peptides, from the silkworm, Bombyx mori.
  •   Journal:Comp. Biochem. Physiol., 1990, 95, 551-554  [MEDLINE:90235568]
  •   [3]  Yamakawa M.,Hirochika H.,Kato Y.,Taniai K.,
  •   Title:Isolation and nucleotide sequence of cecropin B cDNA clones from the silkworm, Bombyx mori.
  •   Journal:Biochim. Biophys. Acta, 1992, 1132, 203-206  [MEDLINE:93003325]
  •   [4]  Yamakawa M.,Hirochika H.,Taniai K.,Kato Y.,
  •   Title:Expression and characterization of cDNAs for cecropin B, an antibacterial protein of the silkworm, Bombyx mori.
  •   Journal:Insect Biochem. Mol. Biol., 1993, 23, 285-290  [MEDLINE:93250869]
  •   [5]  Morishima I.,Kawabata T.,Inoue K.,Matsumoto M.,Yamano Y.,
  •   Title:Cloning of cDNAs for cecropins A and B, and expression of the genes in the silkworm, Bombyx mori.
  •   Journal:Biosci. Biotechnol. Biochem., 1994, 58, 1476-1478  [MEDLINE:94369101]
  •   [6]  Brey P.T.,Lee W.-J.,
  •   Title:Isolation and identification of cecropin antibacterial peptides from the extracellular matrix of the insect integument.
  •   Journal:Anal. Biochem., 1994, 217, 231-235  [MEDLINE:94263044]
  •   [7]  Shimabukuro M.,Yamamoto M.,Kato Y.,Kadono-Okuda K.,Taniai K.,
  •   Title:Structure of two cecropin B-encoding genes and bacteria-inducible DNA-binding proteins which bind to the 5"-upstream regulatory region in the silkworm, Bombyx mori.
  •   Journal:Gene, 1995, 163, 215-219  [MEDLINE:96011636]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: