Record in detail


General Info

  • lamp_id:L03A000201
  • Name:CECB_DROME
  • FullName:Cecropin-B
  • Source:Drosophila melanogaster
  • Mass:6777.9 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.65
  • Activity:Antimicrobial
  • Sequence
        MNFNKIFVFVALILAISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000201    From 1 To 63 E-value: 3e-31 Score: 125
        MNFNKIFVFVALILAISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • 2. L03A000202    From 1 To 63 E-value: 6e-31 Score: 124
        MNFNKIFVFVALILAISLGNTEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • 3. L12A08719|    From 1 To 63 E-value: 9e-31 Score: 124
        MNFNKIFVFVALILVISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • 4. L03A000200    From 1 To 63 E-value: 1e-30 Score: 123
        MNFNKIFVFMALILAISLGNTEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • 5. L12A08773|    From 1 To 63 E-value: 1e-27 Score: 113
        MNFYKIFVFVALILAISVGQSEAGWLKKLGKRLERVGQHTRDATIQVVGIAQQAANVAATARG

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   2  Name:Cecropin_diptera    Interpro Link:IPR020400
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hultmark D.,Samakovlis C.,Kylsten P.,
  •   Title:The cecropin locus in Drosophila; a compact gene cluster involved in the response to infection.
  •   Journal:EMBO J., 1990, 9, 217-224  [MEDLINE:90107946]
  •   [2]  Hultmark D.,Engstrom A.,Kylsten P.,Kimbrell D.A.,Samakovlis C.,
  •   Title:The immune response in Drosophila: pattern of cecropin expression and biological activity.
  •   Journal:EMBO J., 1990, 9, 2969-2976  [MEDLINE:90361012]
  •   [3]  Wang L.,Clark A.G.,
  •   Title:Molecular population genetics of Drosophila immune system genes.
  •   Journal:Genetics, 1997, 147, 713-724  [MEDLINE:97476321]
  •   [4]  Chigusa S.I.,Takahata N.,Satta Y.,Date A.,
  •   Title:Evolutionary history and mechanism of the Drosophila cecropin gene family.
  •   Journal:Immunogenetics, 1998, 47, 417-429  [MEDLINE:98221115]
  •   [5]  Aguade M.,Ramos-Onsins S.,
  •   Title:Molecular evolution of the Cecropin multigene family in Drosophila: functional genes vs pseudogenes.
  •   Journal:Genetics, 1998, 150, 157-171  [MEDLINE:98393576]
  •   [6]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [7]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: