Record in detail


General Info

  • lamp_id:L03A000207
  • Name:CEC1_CERCA
  • FullName:Cecropin-1
  • Source:Ceratitis capitata
  • Mass:6749.9 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.31
  • Activity:Antimicrobial
  • Sequence
        MNFNKVFILVAIVIAIFAGQTEAGWLKKIGKKIERVGQHTRDATIQTIAVAQQAANVAATARG
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q06589
  •   2  Database:AMD  CEC1_CERCA

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000207    From 1 To 63 E-value: 1e-30 Score: 123
        MNFNKVFILVAIVIAIFAGQTEAGWLKKIGKKIERVGQHTRDATIQTIAVAQQAANVAATARG
  • 2. L03A000209    From 1 To 63 E-value: 2e-25 Score: 106
        MNFQNIFIFVALILAVFAGQSQAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG
  • 3. L12A08768|    From 1 To 63 E-value: 1e-24 Score: 103
        MNFYKIFIFVALILAISVGQSEAGWLKKLGKRLERVGQHTRDATIQVVGIAQQAANVAATARG
  • 4. L03A000202    From 1 To 63 E-value: 1e-24 Score: 103
        MNFNKIFVFVALILAISLGNTEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • 5. L12A08773|    From 1 To 63 E-value: 2e-24 Score: 102
        MNFYKIFVFVALILAISVGQSEAGWLKKLGKRLERVGQHTRDATIQVVGIAQQAANVAATARG

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   2  Name:Cecropin_diptera    Interpro Link:IPR020400
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Telford J.L.,Dallai R.,Marchini D.,Manetti A.G.O.,Rosetto M.,
  •   Title:Sequences of two cDNA clones from the medfly Ceratitis capitata encoding antibacterial peptides of the cecropin family.
  •   Journal:Gene, 1993, 134, 241-243  [MEDLINE:94085784]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: