Record in detail


General Info

  • lamp_id:L03A000208
  • Name:TNFA_BOVIN
  • FullName:Tumor necrosis factor
  • Source:Bos taurus
  • Mass:6735.9 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.08
  • Activity:Antimicrobial
  • Sequence
        MNFNKVLVLLAVIFAVFAGQTEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG
  • Function:Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q06599
  •   2  Database:AMD  CEC2_CERCA

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000208    From 1 To 63 E-value: 6e-31 Score: 124
        MNFNKVLVLLAVIFAVFAGQTEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG
  • 2. L03A000209    From 1 To 63 E-value: 5e-24 Score: 101
        MNFQNIFIFVALILAVFAGQSQAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG
  • 3. L03A000200    From 1 To 63 E-value: 2e-23 Score: 99.4
        MNFNKIFVFMALILAISLGNTEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG
  • 4. L12A08769|    From 1 To 63 E-value: 2e-23 Score: 99
        MNFYKIFVFIALILAIAIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG
  • 5. L03A000202    From 1 To 63 E-value: 4e-23 Score: 98.6
        MNFNKIFVFVALILAISLGNTEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG

Structure

  •   Domains
  •   1  Name:TNF    Interpro Link:IPR006052
  •   2  Name:TNF_a/b/c    Interpro Link:IPR006053
  •   3  Name:TNF_alpha    Interpro Link:IPR002959
  •   4  Name:TNF_CS    Interpro Link:IPR021184
  •   5  Name:Tumour_necrosis_fac-like    Interpro Link:IPR008983
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Droogmans L.,Burny A.,Kettmann R.,Cleuter Y.,Cludts I.,
  •   Title:Cloning and characterization of the tandemly arranged bovine lymphotoxin and tumour necrosis factor-alpha genes.
  •   Journal:Cytokine, 1993, 5, 336-341  [MEDLINE:94083525]
  •   [2]  Gaidulis L.,Muriuki M.,Mertens B.E.L.C.,
  •   Title:Cloning of two members of the TNF-superfamily in cattle: CD40 ligand and tumor necrosis factor alpha.
  •   Journal:Immunogenetics, 1995, 42, 430-431  [MEDLINE:96006582]
  •   [3]  Kehrli M.E. Jr.,Womack J.E.,Neibergs H.L.,Dietz A.B.,
  •   Title:Rapid communication: single strand conformational polymorphism (SSCP) of bovine tumor necrosis factor alpha.
  •   Journal:J. Anim. Sci., 1997, 75, 2567-2567  [MEDLINE:97447737]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: