Record in detail


General Info

  • lamp_id:L03A000210
  • Name:CECA_ANOGA
  • FullName:Cecropin-A
  • Source:Anopheles gambiae
  • Mass:6158.5 Da
  • Sequence Length:58 aa
  • Isoelectric Point:11.09
  • Activity:Antimicrobial
  • Sequence
        MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKALG
  • Function:Antibacterial activity against several Gram-positive and Gram-negative bacteria. Antifungal activity against A.fumigatus, B.cinerea, F.culmorum, F.oxysporum, N.crassa, C.albicans, C.neoformans and S.cerevisiae.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000210    From 1 To 58 E-value: 9e-27 Score: 110
        MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKALG
  • 2. L12A08739|    From 1 To 58 E-value: 2e-26 Score: 109
        MNFSKIFIFVVLAVVLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKALG
  • 3. L12A08736|    From 1 To 58 E-value: 2e-26 Score: 108
        MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVTGVKALG
  • 4. L12A08738|    From 1 To 58 E-value: 2e-26 Score: 108
        MNFSKIFIFVVLAVLLLCSQTEAGRLKNLGKKIEGAGKRVFKAAEKALPVVAGVKALG
  • 5. L12A08737|    From 1 To 58 E-value: 3e-26 Score: 108
        MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGVGKRVFKAAEKALPVVAGVKALG

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Blass C.,Lowenberger C.,Charlet M.,Bulet P.,Vizioli J.,
  •   Title:Cloning and analysis of a cecropin gene from the malaria vector mosquito, Anopheles gambiae.
  •   Journal:Insect Mol. Biol., 2000, 9, 75-84  [MEDLINE:20137864]
  •   [2]  Zheng A.L.,Zheng X.-L.,
  •   Title:Genomic organization and regulation of three cecropin genes in Anopheles gambiae.
  •   Journal:Insect Mol. Biol., 2002, 11, 517-525  [PubMed:12421409]
  •   [3]  Charlab R.,Sutton G.G.,Halpern A.,Subramanian G.M.,Holt R.A.,
  •   Title:The genome sequence of the malaria mosquito Anopheles gambiae.
  •   Journal:Science, 2002, 298, 129-149  [MEDLINE:22251359]
  •   [4]  Antonio-Nkondjo C.,Awono-Ambene P.H.,Marshall J.C.,Parmakelis A.,Slotman M.A.,
  •   Title:Patterns of selection in anti-malarial immune genes in malaria vectors: evidence for adaptive evolution in LRIM1 in Anopheles arabiensis.
  •   Journal:PLoS ONE, 2007, 2, 0-0  [PubMed:17726523]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: