Record in detail


General Info

  • lamp_id:L03A000222
  • Name:CECA_AEDAE
  • FullName:Cecropin-A
  • Source:Aedes aegypti
  • Mass:6150.4 Da
  • Sequence Length:59 aa
  • Isoelectric Point:11.31
  • Activity:Antimicrobial
  • Sequence
        MNFTKLFLLIAVAVLLLTGQSEAGGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALRK
  • Function:Antibacterial activity against Gram-negative bacteria E.coli D22 and D31, E.carotovora, K.pneumoniae, P.aeruginosa, S.typhimurium, E.cloacae B12 and X.campestris and Gram-positive bacteria A.viridans, M.luteus, B.megaterium and S.pyogenes. Possesses antifungal activity against F.oxysporum, F.culmorum and N.crassa, C.albicans, C.neoformans and S.cerevisiae. No activity against Gram-negative S.marcescens Db11, Gram-positive B.cereus, B.subtilis, B.thuringiensis, S.aureus and L.monocytogenes, the fungi A.fumigatus and B.bassiana and C.glabrata.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P82592
  •   2  Database:AMD  CECA_AEDAE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000222    From 1 To 59 E-value: 1e-26 Score: 109
        MNFTKLFLLIAVAVLLLTGQSEAGGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALRK
  • 2. L12A08733|    From 1 To 57 E-value: 3e-19 Score: 85.9
        MNFSKIFFIVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKAL
  • 3. L03A000210    From 1 To 57 E-value: 3e-19 Score: 85.9
        MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKAL
  • 4. L12A08732|    From 1 To 57 E-value: 4e-19 Score: 85.1
        MNFSKIFFFVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKAL
  • 5. L12A08739|    From 1 To 57 E-value: 5e-19 Score: 84.7
        MNFSKIFIFVVLAVVLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKAL

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Richman A.,Kamal S.,Vizioli J.,Charlet M.,Lowenberger C.A.,
  •   Title:Antimicrobial activity spectrum, cDNA cloning and mRNA expression of a newly isolated member of the cecropin family from the mosquito vector Aedes aegypti.
  •   Journal:J. Biol. Chem., 1999, 274, 20092-20097  [MEDLINE:99329007]
  •   [2]  Kodira C.D.,Haas B.J.,Lawson D.,Wortman J.R.,Nene V.,
  •   Title:Genome sequence of Aedes aegypti, a major arbovirus vector.
  •   Journal:Science, 2007, 316, 1718-1723  [PubMed:17510324]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: