Record in detail


General Info

  • lamp_id:L03A000227
  • Name:STMX_STOCA
  • FullName:Stomoxyn
  • Source:Stomoxys calcitrans
  • Mass:7173.5 Da
  • Sequence Length:67 aa
  • Isoelectric Point:10.55
  • Activity:Antimicrobial
  • Sequence
        MNFYKYLVVLVVLVLCLSATQTEARGFRKHFNKLVKKVKHTISETAHVAKDTAVIAGSGAAVVAATG
  • Function:Has antimicrobial activity against most Gram-positive and Gram-negative bacteria, filamentous fungi and yeasts tested. Has trypanolytic effect on T.b.rhodesiense and limited hemolytic activity against bovine red blood cells.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000227    From 1 To 67 E-value: 1e-33 Score: 133
        MNFYKYLVVLVVLVLCLSATQTEARGFRKHFNKLVKKVKHTISETAHVAKDTAVIAGSGAAVVAATG
  • 2. L13A022946    From 1 To 33 E-value: 0.00000000000004 Score: 68.2
        RGFRKHFNKLVKKVKHTISETAHVAKDTAVIAG
  • 3. L13A011665    From 1 To 33 E-value: 0.00000000000004 Score: 68.2
        RGFRKHFNKLVKKVKHTISETAHVAKDTAVIAG
  • 4. L13A015838    From 1 To 42 E-value: 0.0000000000003 Score: 65.5
        GFRKRFNKLVKKVKHTIKETANVSKDVAIVAGSGVAVGAAMG
  • 5. L13A026983    From 2 To 43 E-value: 0.0000000000003 Score: 65.5
        GFRKRFNKLVKKVKHTIKETANVSKDVAIVAGSGVAVGAAMG

Structure

  •   Domains
  •   1  Name:Stomoxyn    Interpro Link:IPR021037
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Brun R.,Vovelle F.,Hamilton J.V.,Munks R.J.L.,Boulanger N.,
  •   Title:Epithelial innate immunity. A novel antimicrobial peptide with antiparasitic activity in the blood-sucking insect Stomoxys calcitrans.
  •   Journal:J. Biol. Chem., 2002, 277, 49921-49926  [PubMed:12372834]
  •   [2]  Vovelle F.,Bulet P.,Boulanger N.,Meudal H.,Landon C.,
  •   Title:Solution structures of stomoxyn and spinigerin, two insect antimicrobial peptides with an alpha-helical conformation.
  •   Journal:Biopolymers, 2006, 81, 92-103  [PubMed:16170803]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: