Record in detail


General Info

  • lamp_id:L03A000237
  • Name:MTK_DROME
  • FullName:Metchnikowin
  • Source:Drosophila melanogaster
  • Mass:5653.5 Da
  • Sequence Length:52 aa
  • Isoelectric Point:9.35
  • Activity:Antimicrobial
  • Sequence
        MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGPIY
  • Function:Potent antifungal and antibacterial activity against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000237    From 1 To 52 E-value: 8e-26 Score: 107
        MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGPIY
  • 2. L12A08948|    From 1 To 52 E-value: 2e-25 Score: 105
        MQLNLGAIFLALLGLMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGPIY
  • 3. L01A000293    From 1 To 26 E-value: 0.00000000005 Score: 58.2
        HRHQGPIFDTRPSPFNPNQPRPGPIY
  • 4. L11A013147    From 1 To 26 E-value: 0.0000000003 Score: 55.5
        HRRQGPIFDTRPSPFNPNQPRPGPIY
  • 5. L01A000707    From 1 To 25 E-value: 0.000000002 Score: 53.1
        RRQGPIFDTRPSPFNPNQPRPGPIY

Structure

  •   Domains
  •   1  Name:Antimicrobial10    Interpro Link:IPR012513
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hetru C.,Reichhart J.-M.,Bulet P.,Ohresser S.,Levashina E.A.,
  •   Title:Metchnikowin, a novel immune-inducible proline-rich peptide from Drosophila with antibacterial and antifungal properties.
  •   Journal:Eur. J. Biochem., 1995, 233, 694-700  [MEDLINE:96067716]
  •   [2]  Hoffmann J.A.,van Dorsselaer A.,Lagueux M.,Moniatte M.,Uttenweiler-Joseph S.,
  •   Title:Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1998, 95, 11342-11347  [MEDLINE:98409659]
  •   [3]  Imler J.-L.,Lemaitre B.,Ohresser S.,Levashina E.A.,
  •   Title:Two distinct pathways can control expression of the gene encoding the Drosophila antimicrobial peptide metchnikowin.
  •   Journal:J. Mol. Biol., 1998, 278, 515-527  [MEDLINE:98263241]
  •   [4]  Gocayne J.D.,Evans C.A.,Holt R.A.,Celniker S.E.,Adams M.D.,
  •   Title:The genome sequence of Drosophila melanogaster.
  •   Journal:Science, 2000, 287, 2185-2195  [MEDLINE:20196006]
  •   [5]  Champe M.,Yu C.,Brokstein P.,Carlson J.W.,Stapleton M.,
  •   Title:A Drosophila full-length cDNA resource.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426066]
  •   [6]  Campbell K.S.,Matthews B.B.,Mungall C.J.,Crosby M.A.,Misra S.,
  •   Title:Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  •   Journal:Genome Biol., 2002, 3, 0-0  [MEDLINE:22426069]
  •   [7]  Clark A.G.,Lazzaro B.P.,
  •   Title:Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster.
  •   Journal:Mol. Biol. Evol., 2003, 20, 914-923  [MEDLINE:22625906]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: