Record in detail


General Info

  • lamp_id:L03A000243
  • Name:DEFB3_MOUSE
  • FullName:Beta-defensin 3
  • Source:Mus musculus
  • Mass:7125.6 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.07
  • Activity:Antimicrobial
  • Sequence
        MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
  • Function:Antimicrobial activity against Gram-negative bacteria E.coli and P.aeruginosa.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000243    From 1 To 63 E-value: 3e-32 Score: 129
        MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
  • 2. L01A003011    From 1 To 41 E-value: 4e-19 Score: 85.1
        KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
  • 3. L13A024267    From 1 To 40 E-value: 1e-18 Score: 83.2
        KINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
  • 4. L03A000151    From 1 To 63 E-value: 5e-17 Score: 78.2
        MKIHYLLFAFILVMLSPLAAFSQLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK
  • 5. L03A000249    From 1 To 63 E-value: 0.000000000000002 Score: 72.8
        MRIHYLLFSFLLVLLSPLSAFTQSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Weiner D.J.,Wattler S.,Meegalla R.L.,Wang X.,Bals R.,
  •   Title:Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs.
  •   Journal:Infect. Immun., 1999, 67, 3542-3547  [MEDLINE:99307216]
  •   [2]  Vivado A.,Lee S.K.,Schutte B.C.,Wowk S.A.,Jia H.P.,
  •   Title:A novel murine beta-defensin expressed in tongue, esophagus, and trachea.
  •   Journal:J. Biol. Chem., 2000, 275, 33314-33320  [MEDLINE:20517883]
  •   [3]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: