Record in detail


General Info

  • lamp_id:L03A000249
  • Name:DEFB4_RAT
  • FullName:Beta-defensin 4
  • Source:Rattus norvegicus
  • Mass:6946.3 Da
  • Sequence Length:63 aa
  • Isoelectric Point:10.1
  • Activity:Antimicrobial
  • Sequence
        MRIHYLLFSFLLVLLSPLSAFTQSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  O88514
  •   2  Database:AMD  BD02_RAT

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000249    From 1 To 63 E-value: 3e-32 Score: 129
        MRIHYLLFSFLLVLLSPLSAFTQSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
  • 2. L03A000151    From 1 To 63 E-value: 4e-20 Score: 88.2
        MKIHYLLFAFILVMLSPLAAFSQLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK
  • 3. L01A003488    From 1 To 41 E-value: 2e-19 Score: 86.3
        QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
  • 4. L03A000251    From 1 To 61 E-value: 2e-18 Score: 83.2
        MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCK
  • 5. L03A000243    From 1 To 63 E-value: 3e-16 Score: 75.5
        MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mallampali R.K.,Nishimura D.,Barahmand-Pour F.,Mills J.N.,Jia H.P.,
  •   Title:Molecular cloning and characterization of rat genes encoding homologues of human beta-defensins.
  •   Journal:Infect. Immun., 1999, 67, 4827-4833  [MEDLINE:99386883]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: