Record in detail


General Info

  • lamp_id:L03A000250
  • Name:DEFB8_MOUSE
  • FullName:Beta-defensin 8
  • Source:Mus musculus
  • Mass:6760.1 Da
  • Sequence Length:60 aa
  • Isoelectric Point:9.52
  • Activity:Antimicrobial
  • Sequence
        MRIHYLLFTFLLVLLSPLAAFSQKINEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK
  • Function:A synthetic peptide displays antimicrobial activities against S.aureus, P.aeruginosa, E.coli and B.cepacia. The antimicrobial activity against S.aureus, E.coli and B.cepacia is reduced in raised concentration of NaCl, but its action against P.aeruginosa is independent of NaCl concentration.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000250    From 1 To 60 E-value: 1e-30 Score: 123
        MRIHYLLFTFLLVLLSPLAAFSQKINEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK
  • 2. L12A09028|    From 1 To 60 E-value: 4e-23 Score: 98.2
        MRIHYLLFTFLLVLLSPLAAFSQKINDPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK
  • 3. L01A003016    From 1 To 35 E-value: 3e-16 Score: 75.5
        NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK
  • 4. L03A000243    From 1 To 61 E-value: 0.00000000000001 Score: 70.1
        MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCK
  • 5. L03A000151    From 1 To 61 E-value: 0.00000000000002 Score: 69.3
        MKIHYLLFAFILVMLSPLAAFSQLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dorin J.R.,Cross S.H.,Kilanowski F.M.,Rolfe M.,Morrison G.M.,
  •   Title:
  •   Journal:Mamm. Genome, 2002, 13, 603-603  [DOI:10.1007/s00335-002-0016-2]
  •   [2]  Forssmann W.-G.,Conejo-Garcia J.-R.,Kluever E.,Schweimer K.,Bauer F.,
  •   Title:Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity.
  •   Journal:Protein Sci., 2001, 10, 2470-2479  [MEDLINE:21571984]
  •   [3]  Dorin J.R.,Cross S.H.,Kilanowski F.M.,Rolfe M.,Morrison G.M.,
  •   Title:Identification and characterisation a novel murine beta defensin related gene.
  •   Journal:Mamm. Genome, 2002, 13, 445-451  [MEDLINE:22213784]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: