Record in detail


General Info

  • lamp_id:L03A000257
  • Name:AMP1_MELGA
  • FullName:Antimicrobial peptide THP1
  • Source:Meleagris gallopavo
  • Mass:7085.5 Da
  • Sequence Length:65 aa
  • Isoelectric Point:10.1
  • Activity:Antimicrobial
  • Sequence
        MRIVYLLFPFILLLAQGAAGSSLALGKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG
  • Function:Bactericidal activity; inhibits S.aureus and E.coli.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000257    From 1 To 65 E-value: 4e-32 Score: 128
        MRIVYLLFPFILLLAQGAAGSSLALGKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG
  • 2. L12A09053|    From 1 To 65 E-value: 4e-20 Score: 88.2
        MRIVYLLFPFILLLVQGAAGSSLAPRNKEKCHREKGFCGFLKCSFPFIISGKCSRFFFCCKKIFG
  • 3. L12A09054|    From 1 To 65 E-value: 6e-19 Score: 84.7
        MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIWG
  • 4. L02A000266    From 1 To 40 E-value: 3e-18 Score: 82.4
        GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG
  • 5. L03A000259    From 1 To 65 E-value: 3e-18 Score: 82.4
        MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Harmon B.G.,Wunderlich J.,Beach G.G.,Evans E.W.,
  •   Title:Isolation of antimicrobial peptides from avian heterophils.
  •   Journal:J. Leukoc. Biol., 1994, 56, 661-665  [MEDLINE:95053386]
  •   [2]  Jackwood M.W.,Harmon B.G.,Brockus C.W.,
  •   Title:Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow.
  •   Journal:Anim. Genet., 1998, 29, 283-289  [MEDLINE:98418188]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: