Record in detail


General Info

  • lamp_id:L03A000258
  • Name:GLL3_CHICK
  • FullName:Gallinacin-3
  • Source:Gallus gallus
  • Mass:6376.6 Da
  • Sequence Length:58 aa
  • Isoelectric Point:9.59
  • Activity:Antimicrobial
  • Sequence
        MRIVYLLIPFFLLFLQGAAGTATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q9DG58
  •   2  Database:AMD  BD03_CHICK

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000258    From 1 To 58 E-value: 2e-28 Score: 115
        MRIVYLLIPFFLLFLQGAAGTATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
  • 2. L05ADEF299    From 1 To 58 E-value: 1e-20 Score: 90.5
        MKILYLLIPFFLLFLQGAAGTATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
  • 3. L03A000256    From 1 To 54 E-value: 1e-16 Score: 76.6
        MRIVYLLFPFFLLFLQSAAGTPIQCRIRGGFCRFGSCRFPHIAIGKCATFIPCC
  • 4. L02A001148    From 2 To 38 E-value: 2e-16 Score: 76.3
        ATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
  • 5. L01A002482    From 1 To 32 E-value: 0.0000000000001 Score: 67
        TQCRIRGGFCRVGSCRFPHIAIGKCATFISCC

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Brogden K.A.,Sacco R.E.,Liu L.,Nguyen T.,Zhao C.,
  •   Title:Gallinacin-3, an inducible epithelial beta-defensin in the chicken.
  •   Journal:Infect. Immun., 2001, 69, 2684-2691  [MEDLINE:21153640]
  •   [2]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [3]  James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
  •   Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
  •   Journal:Immunogenetics, 2004, 56, 170-177  [PubMed:15148642]
  •   [4]  Isobe N.,Nishibori M.,Subedi K.,Ohashi H.,Yoshimura Y.,
  •   Title:Effects of age, egg-laying activity, and Salmonella-inoculation on the expressions of gallinacin mRNA in the vagina of the hen oviduct.
  •   Journal:J. Reprod. Dev., 2006, 52, 211-218  [PubMed:16394622]
  •   [5]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: