Record in detail


General Info

  • lamp_id:L03A000260
  • Name:O97942_CAPHI
  • FullName:
  • Source:Capra hircus
  • Mass:7164.6 Da
  • Sequence Length:64 aa
  • Isoelectric Point:11.16
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLALFFLVLSAGSGFTQGIINHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000260    From 1 To 64 E-value: 2e-33 Score: 132
        MRLHHLLLALFFLVLSAGSGFTQGIINHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • 2. L12A04055|    From 1 To 47 E-value: 2e-23 Score: 99.8
        GSGFTQGIINHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • 3. L03A000264    From 1 To 64 E-value: 1e-19 Score: 86.7
        MRLHHLLLVLFFLVLSAGSGFTQGIRSRRSCHRNKGVCALTRCPRNMRQIGTCFGPPVKCCRKK
  • 4. L12A04736|    From 15 To 63 E-value: 2e-19 Score: 86.3
        SAGSGFTQGIRSRRSCHRNKGVCALTRCPRNMRQIGTCFGPPVKCCRKK
  • 5. L03A000266    From 1 To 64 E-value: 4e-19 Score: 85.1
        MRLHHLLLVLFFVVLSAGSGFTQGVRNRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Brogden K.,Shamova O.,Liu L.,Nguyen T.,Zhao C.,
  •   Title:Differential expression of caprine beta-defensins in digestive and respiratory tissues.
  •   Journal:Infect. Immun., 1999, 67, 6221-6224  [MEDLINE:20002622]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: