Record in detail


General Info

  • lamp_id:L03A000262
  • Name:DEFB4_BOVIN
  • FullName:Beta-defensin 4
  • Source:Bos taurus
  • Mass:7160.6 Da
  • Sequence Length:63 aa
  • Isoelectric Point:11.96
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000262    From 1 To 63 E-value: 6e-32 Score: 127
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 2. L12A09085|    From 1 To 63 E-value: 3e-31 Score: 125
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFWCRVGMRQIGTCFGPRVPCCRR
  • 3. L12A09083|    From 1 To 63 E-value: 3e-25 Score: 105
        MRLHHLLLAVLFLDLSAGSGFTQSVRNPQSCRWNMDVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 4. L05A0DEF73    From 1 To 43 E-value: 9e-21 Score: 90.5
        FTQRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 5. L03A000267    From 1 To 63 E-value: 1e-19 Score: 87
        MRLHHLLLVLLFLVLSAGSGFTQVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
  •   Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
  •   Journal:J. Biol. Chem., 1993, 268, 6641-6648  [MEDLINE:93203264]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: