Record in detail


General Info

  • lamp_id:L03A000263
  • Name:EAP_BOVIN
  • FullName:Enteric beta-defensin
  • Source:Bos taurus
  • Mass:7126.5 Da
  • Sequence Length:64 aa
  • Isoelectric Point:11.17
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLTLLFLVLSAGSGFTQGISNPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR
  • Function:Has antibacterial activity (Potential).

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  O02775
  •   2  Database:AMD  EAP_BOVIN

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000263    From 1 To 64 E-value: 3e-32 Score: 129
        MRLHHLLLTLLFLVLSAGSGFTQGISNPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR
  • 2. L12A09088|    From 1 To 64 E-value: 1e-31 Score: 126
        MRLHHLLLTLLFLVLSAGSGFTQGISNPLSCRLNRGICVPIRCPGNLRQIGTCFRPSVKCCRWR
  • 3. L03A000069    From 1 To 55 E-value: 3e-20 Score: 89
        LALLFLVLSAGSGFTQGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCR
  • 4. L03A000068    From 1 To 55 E-value: 6e-20 Score: 87.8
        LALLFLVLSAGSGFTQGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR
  • 5. L12A09074|    From 1 To 62 E-value: 2e-19 Score: 85.9
        MRLHHLLLALLFLVLSAGSGFTQGISNPLSCRRNKGICLPIRCPGSMRQIGTCFGPRVKCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Womack J.E.,Bevins C.L.,Diamond G.,Ryan A.M.,Gallagher D.S. Jr.,
  •   Title:Somatic cell mapping of beta-defensin genes to cattle syntenic group U25 and fluorescence in situ localization to chromosome 27.
  •   Journal:Mamm. Genome, 1995, 6, 554-556  [MEDLINE:96014297]
  •   [2]  Erdjument-Bromage H.,Russell J.P.,Diamond G.,Clark D.P.,Tarver A.P.,
  •   Title:Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
  •   Journal:Infect. Immun., 1998, 66, 1045-1056  [MEDLINE:98147718]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: