Record in detail


General Info

  • lamp_id:L03A000267
  • Name:DEFB5_BOVIN
  • FullName:Beta-defensin 5
  • Source:Bos taurus
  • Mass:7227.7 Da
  • Sequence Length:64 aa
  • Isoelectric Point:10.53
  • Activity:Antimicrobial
  • Sequence
        MRLHHLLLVLLFLVLSAGSGFTQVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW
  • Function:Has bactericidal activity. Active against E.coli ML35 but not against S.aureus 502A.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000267    From 1 To 64 E-value: 7e-33 Score: 130
        MRLHHLLLVLLFLVLSAGSGFTQVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW
  • 2. L12A09083|    From 1 To 63 E-value: 2e-21 Score: 92.8
        MRLHHLLLAVLFLDLSAGSGFTQSVRNPQSCRWNMDVCIPFLCRVGMRQIGTCFGPRVPCCRR
  • 3. L02A000040    From 1 To 42 E-value: 2e-20 Score: 89.4
        QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW
  • 4. L03A000069    From 1 To 57 E-value: 1e-19 Score: 87
        LALLFLVLSAGSGFTQGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
  • 5. L03A000262    From 1 To 63 E-value: 2e-19 Score: 85.9
        MRLHHLLLAVLFLVLSAGSGFTQRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
  •   Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
  •   Journal:J. Biol. Chem., 1993, 268, 6641-6648  [MEDLINE:93203264]
  •   [2]  Diamond G.,Bhat M.,Rhodes J.,Ryan L.K.,
  •   Title:Expression of beta-defensin genes in bovine alveolar macrophages.
  •   Journal:Infect. Immun., 1998, 66, 878-881  [MEDLINE:98114406]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: