Record in detail


General Info

  • lamp_id:L03A000268
  • Name:DEFB1_PIG
  • FullName:Beta-defensin 1
  • Source:Sus scrofa
  • Mass:7065.9 Da
  • Sequence Length:64 aa
  • Isoelectric Point:11
  • Activity:Antimicrobial
  • Sequence
        MRLHRLLLVFLLMVLLPVPGLLKNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000268    From 1 To 64 E-value: 5e-31 Score: 124
        MRLHRLLLVFLLMVLLPVPGLLKNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
  • 2. L01A000519    From 1 To 42 E-value: 4e-19 Score: 85.1
        KNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
  • 3. L05ADEF106    From 1 To 41 E-value: 1e-18 Score: 83.6
        NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
  • 4. L02A001597    From 1 To 37 E-value: 3e-16 Score: 75.5
        SVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
  • 5. L12A11906|    From 1 To 34 E-value: 0.00000000000002 Score: 69.7
        VSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ross C.,Ganz T.,Shi J.,Wu H.,Zhang G.,
  •   Title:Molecular cloning and tissue expression of porcine beta-defensin-1.
  •   Journal:FEBS Lett., 1998, 424, 37-40  [MEDLINE:98196859]
  •   [2]  Ross C.R.,Wu H.,Yasue H.,Hiraiwa H.,Zhang G.,
  •   Title:Cloning and characterization of the gene for a new epithelial beta-defensin. Genomic structure, chromosomal localization, and evidence for its constitutive expression.
  •   Journal:J. Biol. Chem., 1999, 274, 24031-24037  [MEDLINE:99377035]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: