Record in detail

lamp_id:L03A000269
Name:PEN3A_LITVA
FullName:Penaeidin-3a
Source:Litopenaeus vannamei
Mass:8748.3 Da
Sequence Length:82 aa
Isoelectric Point:9.77
Activity:Antimicrobial
Sequence
MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYSG
Function:Antibacterial activity against M.luteus and E.coli bacteria. Antifungal activity against N.crassa and F.oxysporum. Presents chitin-binding activity.

Top similar AMPs on LAMP
1. L03A000269 From 1 To 82 E-value: 8.00001e-42 Score: 160
MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYSG
2. L12A09137| From 1 To 82 E-value: 9.99967e-42 Score: 160
MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPISCRGISFSQARSCCSRLGRCCHVGKGYSG
3. L01A001373 From 1 To 82 E-value: 9.99967e-42 Score: 159
MRLVVCLVFLASFALVCQGQVYKGGYTRPVPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYSG
4. L12A09105| From 1 To 82 E-value: 3.00004e-41 Score: 158
MRLVACLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPISCRGISFSQARSCCSRLGRCCHVGKGYSG
5. L12A09141| From 1 To 82 E-value: 3.00004e-41 Score: 158
MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPISPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYSG

Reference
[1] Rodriguez J.,van Dorsselaer A.,Loew D.,Bulet P.,Destoumieux D.,
Title:Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda).
Journal:J. Biol. Chem., 1997, 272, 28398-28406 [MEDLINE:98019209]
[2] Bachere E.,van Dorsselaer A.,Strub J.-M.,Bulet P.,Destoumieux D.,
Title:Recombinant expression and range of activity of penaeidins, antimicrobial peptides from penaeid shrimp.
Journal:Eur. J. Biochem., 1999, 266, 335-346 [MEDLINE:21060118]
[3] Bachere E.,Bulet P.,Munoz M.,Destoumieux D.,
Title:Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda).
Journal:Cell. Mol. Life Sci., 2000, 57, 1260-1271 [MEDLINE:20479888]
[4] Bulet P.,Rodriguez J.,Cosseau C.,Munoz M.,Destoumieux D.,
Title:Penaeidins, antimicrobial peptides with chitin-binding activity, are produced and stored in shrimp granulocytes and released after microbial challenge.
Journal:J. Cell Sci., 2000, 113, 461-469 [MEDLINE:20107129]
[5] Gross P.S.,Chapman R.W.,Shepard E.F.,Cuthbertson B.J.,
Title:Diversity of the penaeidin antimicrobial peptides in two shrimp species.
Journal:Immunogenetics, 2002, 54, 442-445 [MEDLINE:22226701]
[6] Bachere E.,Zatylny C.,Garnier J.,Poncet J.,Yang Y.,
Title:Solution structure of the recombinant penaeidin-3, a shrimp antimicrobial peptide.
Journal:J. Biol. Chem., 2003, 278, 36859-36867 [PubMed:12842879]