Record in detail


General Info

  • lamp_id:L03A000283
  • Name:DEF1_RABIT
  • FullName:Corticostatin 1
  • Source:Oryctolagus cuniculus
  • Mass:10343.7 Da
  • Sequence Length:93 aa
  • Isoelectric Point:7.76
  • Activity:Antimicrobial
  • Sequence
        MRTLILLAAILLAALQAQAELFSVNVDEVLDQQQPGSDQDLVIHLTGEESSALQVPDTKGICACRRRFCPNSERFSGYCRVNGARYVRCCSRR
  • Function:Microbicidal activity and inhibits corticotropin (ACTH) stimulated corticosterone production.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000283    From 1 To 93 E-value: 0 Score: 190
        MRTLILLAAILLAALQAQAELFSVNVDEVLDQQQPGSDQDLVIHLTGEESSALQVPDTKGICACRRRFCPNSERFSGYCRVNGARYVRCCSRR
  • 2. L05ADEF181    From 1 To 93 E-value: 1e-18 Score: 83.6
        MRTLTLLSAFLLVALQAWAEPLQARADEMPAQKQPPADDQDVVIYFSGDDSSSLQVPGSTKGLICHCRVLYCLFGEHLGGTSFIHGERYPICC
  • 3. L12A08378|    From 1 To 93 E-value: 5e-18 Score: 81.3
        MKVLVLLAAIFLVAIQAQADPLPARTEEALDQEQFGAEDQDVPVDFAGEESSALRAAGLRSTLTCYCRSGYCIGSERLSGNCKINNRFYYLCC
  • 4. L12A09213|    From 1 To 93 E-value: 3e-16 Score: 75.5
        MRTLAILAAILLVALQAQAESLQERADETATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRIGLCAAIESYSGRCYINGRSYRLCC
  • 5. L12A08310|    From 1 To 93 E-value: 5e-16 Score: 74.7
        MKTIAILAAILLVALQAQAESLQERADEAATQKQSGEDNQDLAVSFAGNGLSTLRASDSQARSTCYCRSGLCAAIESYSGRCYISGRRYRLCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Harwig S.S.L.,Delange R.J.,Brown D.M.,Selsted M.E.,
  •   Title:Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils.
  •   Journal:J. Biol. Chem., 1985, 260, 4579-4584  [MEDLINE:85182561]
  •   [2]  Solomon S.,Shimasaki S.,Esch F.,Hu J.,Zhu Q.,
  •   Title:Isolation and structure of corticostatin peptides from rabbit fetal and adult lung.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1988, 85, 592-596  [MEDLINE:88124887]
  •   [3]  Solomon S.,Zhu Q.,
  •   Title:Isolation and mode of action of rabbit corticostatic (antiadrenocorticotropin) peptides.
  •   Journal:Endocrinology, 1992, 130, 1413-1423  [MEDLINE:92164536]
  •   [4]  Ganz T.,Liu L.,Michaelson D.,Linzmeier R.,
  •   Title:The structure of neutrophil defensin genes.
  •   Journal:FEBS Lett., 1993, 321, 267-273  [MEDLINE:93238968]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: