Record in detail


General Info

  • lamp_id:L03A000287
  • Name:DEF3A_RAT
  • FullName:Neutrophil antibiotic peptide NP-3
  • Source:Rattus norvegicus
  • Mass:9340.6 Da
  • Sequence Length:87 aa
  • Isoelectric Point:7.76
  • Activity:Antimicrobial
  • Sequence
        MRTLTLLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCSCRTSSCRFGERLSGACRLNGRIYRLCC
  • Function:Active in vitro against S.aureus, fungi, Gram-positive and Gram-negative bacteria and to a lesser extent against an enveloped virus.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000287    From 1 To 87 E-value: 0 Score: 176
        MRTLTLLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCSCRTSSCRFGERLSGACRLNGRIYRLCC
  • 2. L12A09232|    From 1 To 87 E-value: 0 Score: 174
        MRTLILLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCSCRTSSCRFGERLSGACRLNGRIYRLCC
  • 3. L03A000286    From 1 To 93 E-value: 4e-27 Score: 111
        MRTLTLLTALLLLALHTQAKSPQGTAEEAPDQEQLVMEDQDISISFGGDKGTALQDADVKAGVTCYCRSTRCGFRERLSGACGYRGRIYRLCC
  • 4. L05ADEF377    From 1 To 90 E-value: 7e-27 Score: 110
        MRTLTLLTALLLLALHTQAESPQGSPKEAPDQEQLDMEDQDISVFFGGDKGTALQDA---AGSTCSCRIGTCVSGEWLSWVCRINGRIYRLCC
  • 5. L03A000285    From 1 To 93 E-value: 7e-27 Score: 110
        MRTLTLLTALLLLALHTQAKSPQGTAEEAPDQEQLVMEDQDISISFGGDKGTALQDADVKAGVTCYCRRTRCGFRERLSGACGYRGRIYRLCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Defensin_propep    Interpro Link:IPR002366
  •   4  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Selsted M.E.,Ganz T.,Szklarek D.,Harwig S.S.S.L.,Eisenhauer P.B.,
  •   Title:Purification and antimicrobial properties of three defensins from rat neutrophils.
  •   Journal:Infect. Immun., 1989, 57, 2021-2027  [MEDLINE:89277517]
  •   [2]  Ouellette A.J.,Banaiee N.,Yuan J.,Wang M.-S.C.,Yount N.Y.,
  •   Title:Rat neutrophil defensins. Precursor structures and expression during neutrophilic myelopoiesis.
  •   Journal:J. Immunol., 1995, 155, 4476-4484  [MEDLINE:96025910]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: