Record in detail


General Info

  • lamp_id:L03A000302
  • Name:LMBC1_LUMRU
  • FullName:Antimicrobial peptide lumbricin-1
  • Source:Lumbricus rubellus
  • Mass:8849 Da
  • Sequence Length:76 aa
  • Isoelectric Point:7.33
  • Activity:Antimicrobial
  • Sequence
        MSLCISDYLYLTLTFSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA
  • Function:Displays antimicrobial activity against the Gram-positive bacteria B.subtilis ATCC 62037, S.aureus ATCC 15752 and S.mutans ATCC 25175, the Gram-negative bacteria E.coli ATCC 27325, P.putida ATCC 17426 and Serratia sp. ATCC 21074, and the fungi C.albicans ATCC 10231, C.neoformans ATCC 34881 and S.cerevisiae ATCC 44774. Does not possess hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000302    From 1 To 76 E-value: 4.00001e-41 Score: 158
        MSLCISDYLYLTLTFSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA
  • 2. L01A003843    From 1 To 62 E-value: 4e-32 Score: 128
        FSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA
  • 3. L13A029009    From 1 To 50 E-value: 1e-24 Score: 103
        FSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEI
  • 4. L01A002882    From 2 To 61 E-value: 2e-23 Score: 99.8
        YSKYERQKDKRPYSERKDQYTGPQFLYPPDRIPPSKAIKWNEEGLPMYEVLPDGAGAKTA
  • 5. L01A003984    From 2 To 62 E-value: 2e-23 Score: 99.8
        YSKYERQKDKRPYSERKDQYTGPQFLYPPDRIPPSKAIKWNEEGLPMYEVLPDGAGAKTAV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kim S.C.,Yoon Y.G.,Park C.B.,Cho J.H.,
  •   Title:Lumbricin I, a novel proline-rich antimicrobial peptide from the earthworm: purification, cDNA cloning and molecular characterization.
  •   Journal:Biochim. Biophys. Acta, 1998, 1408, 67-76  [MEDLINE:99002919]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: