Record in detail


General Info

  • lamp_id:L03A000304
  • Name:PHYB_PHYBI
  • FullName:Phylloxin
  • Source:Phyllomedusa bicolor
  • Mass:7256.4 Da
  • Sequence Length:64 aa
  • Isoelectric Point:5.1
  • Activity:Antimicrobial
  • Sequence
        MVFLKKSLLLVLFVGLVSLSICEENKREEHEEIEENKEKAEEKRGWMSKIASGIGTFLSGMQQG
  • Function:Antimicrobial peptide against the wall-less bacteria A.laidlawii and S.melliferum, the Gram-positive bacteria B.megaterium KM, C.glutamicum ATCC 27853 and M.luteus ATCC 27853 and the Gram-negative-bacteria R.meliloti 102F34 and E.coli K12.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000304    From 1 To 64 E-value: 3e-31 Score: 125
        MVFLKKSLLLVLFVGLVSLSICEENKREEHEEIEENKEKAEEKRGWMSKIASGIGTFLSGMQQG
  • 2. L12A06177|    From 1 To 57 E-value: 0.0000000001 Score: 57
        MAFLKKSLFLVLFLGFVSVSICEEEKRQEDEDEHVEEGENQEEGSEEKRGLLSVLGS
  • 3. L12A11233|    From 23 To 82 E-value: 0.00000006 Score: 48.1
        MAFLKKSLFLVLFLGFISISFCDEEKIQDDDEASEREEKKEIHEEGNQEERRAVPPQGWM
  • 4. L12A06176|    From 1 To 57 E-value: 0.0000002 Score: 46.6
        MAFLKKSLFLGLFLGFVSVSICEEEKRQEDEDEHDEEGENQEEGSEEKRGLLSVLGS
  • 5. L12A07163|    From 1 To 48 E-value: 0.0000008 Score: 44.3
        MFTLKKSMLLIFFLGTISLSLCE----QERDADEEDGEK-EVKRGILSLITTG

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nicolas P.,Amiche M.,Seon A.A.,Pierre T.P.,
  •   Title:Phylloxin, a novel peptide antibiotic of the dermaseptin family of antimicrobial/opioid peptide precursors.
  •   Journal:Eur. J. Biochem., 2000, 267, 370-378  [MEDLINE:20098513]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: