Record in detail


General Info

  • lamp_id:L03A000306
  • Name:ANTF_SARPE
  • FullName:Antifungal protein
  • Source:Sarcophaga peregrina
  • Mass:9017.9 Da
  • Sequence Length:85 aa
  • Isoelectric Point:7.57
  • Activity:Antimicrobial
  • Sequence
        MVKLFVIVILALIAVAFGQHGHGGQDQHGYGHGQQAVYGKGHEGHGVNNLGQDGHGQHGYAHGHSDQHGHGGQHGQHDGYKNRGY
  • Function:This protein inhibits the growth of a variety of fungal species. The antifungal activity of this protein is enhanced by the presence of sarcotoxin IA.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000306    From 1 To 85 E-value: 2e-40 Score: 156
        MVKLFVIVILALIAVAFGQHGHGGQDQHGYGHGQQAVYGKGHEGHGVNNLGQDGHGQHGYAHGHSDQHGHGGQHGQHDGYKNRGY
  • 2. L13A012085    From 1 To 50 E-value: 2e-20 Score: 89.7
        QHGHGGQDQHGYGHGQQAVYGKGHEGHGVNNLGQDGHGQHGYAHGHSDQH
  • 3. L01A002964    From 1 To 67 E-value: 3e-20 Score: 88.6
        QHGHGGQDQHGYGHGQQAVYGKGHEGHGVNNLGQDGHGQHGYAHGHSDQHGHGGQHGQHDGYKNRGY
  • 4. L12A08725|    From 5 To 30 E-value: 0.12 Score: 26.9
        KLFVIVLLAALAF-FGQAEAGGLKKFG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Natori S.,Kurata S.,Iijima R.,
  •   Title:Purification, characterization, and cDNA cloning of an antifungal protein from the hemolymph of Sarcophaga peregrina (flesh fly) larvae.
  •   Journal:J. Biol. Chem., 1993, 268, 12055-12061  [MEDLINE:93280179]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: