Record in detail


General Info

  • lamp_id:L03A000310
  • Name:AMP_AMACA
  • FullName:Antimicrobial peptide 2
  • Source:Amaranthus caudatus
  • Mass:8911.5 Da
  • Sequence Length:86 aa
  • Isoelectric Point:8.5
  • Activity:Antimicrobial
  • Sequence
        MVNMKCVALIVIVMMAFMMVDPSMGVGECVRGRCPSGMCCSQFGYCGKGPKYCGRASTTVDHQADVAATKTAKNPTDAKLAGAGSP
  • Function:Chitin-binding protein with a defensive function against numerous chitin containing fungal pathogens. It is also a potent inhibitor of Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000310    From 1 To 86 E-value: 0 Score: 176
        MVNMKCVALIVIVMMAFMMVDPSMGVGECVRGRCPSGMCCSQFGYCGKGPKYCGRASTTVDHQADVAATKTAKNPTDAKLAGAGSP
  • 2. L12A09584|    From 1 To 89 E-value: 7e-37 Score: 144
        MVNMKSVALIVIVMMAFMMVDPSMGAGECVQGRCPSGMCCSQFGYCGRGPKYCGRASTTVDHQADAAAAAATKTANNPTDAKLAGAGSP
  • 3. L01A000210    From 1 To 30 E-value: 0.0000000000002 Score: 66.2
        VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
  • 4. L12A11744|    From 1 To 30 E-value: 0.0000000000005 Score: 65.1
        VGECVRGRCPSGMCCSQFGFCGKGPKYCGR
  • 5. L12A11747|    From 1 To 30 E-value: 0.0000000000005 Score: 65.1
        VGECVRGRCPSGMCCSQWGYCGKGPKYCGR

Structure

  •   Domains
  •   1  Name:Antimicrobial_C6_CS    Interpro Link:IPR013006
  •   2  Name:Chitin-bd_1    Interpro Link:IPR001002
  •   3  Name:Chitin-binding_1_CS    Interpro Link:IPR018371
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Proost P.,de Bolle M.F.C.,Terras F.R.G.,Marien W.,Broekaert W.F.,
  •   Title:Antimicrobial peptides from Amaranthus caudatus seeds with sequence homology to the cysteine/glycine-rich domain of chitin-binding proteins.
  •   Journal:Biochemistry, 1992, 31, 4308-4314  [MEDLINE:92232738]
  •   [2]  Cammue B.P.A.,Vanderleyden J.,Rees S.B.,David K.M.M.,de Bolle M.F.C.,
  •   Title:Cloning and characterization of a cDNA encoding an antimicrobial chitin-binding protein from amaranth, Amaranthus caudatus.
  •   Journal:Plant Mol. Biol., 1993, 22, 1187-1190  [MEDLINE:94003078]
  •   [3]  Wyns L.,Pepermans H.A.M.,Loris R.,Maes D.,Martins J.C.,
  •   Title:H NMR study of the solution structure of Ac-AMP2, a sugar binding antimicrobial protein isolated from Amaranthus caudatus.
  •   Journal:J. Mol. Biol., 1996, 258, 322-333  [MEDLINE:96196483]
  •   [4]  Tourwe D.,Wyns L.,Verheyden P.,Laus G.,el Boiyoussfi M.,
  •   Title:Location of the three disulfide bonds in an antimicrobial peptide from Amaranthus caudatus using mass spectrometry.
  •   Journal:J. Pept. Res., 1997, 49, 336-340  [MEDLINE:97319931]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: