Record in detail

lamp_id:L03A000313
Name:XENO_XENLA
FullName:Xenopsin peptides
Source:Xenopus laevis
Mass:8962.4 Da
Sequence Length:81 aa
Isoelectric Point:8.74
Activity:Antimicrobial
Sequence
MYKGIFLCVLLAVICANSLATPSSDADEDNDEVERYVRGWASKIGQTLGKIAKVGLKELIQPKREAMLRSAEAQGKRPWIL
Function:Xenopsin is a neurotensin-like octapeptide.

Top similar AMPs on LAMP
1. L03A000313 From 1 To 81 E-value: 8.96831e-44 Score: 166
MYKGIFLCVLLAVICANSLATPSSDADEDNDEVERYVRGWASKIGQTLGKIAKVGLKELIQPKREAMLRSAEAQGKRPWIL
2. L03A000312 From 1 To 75 E-value: 2e-37 Score: 145
MYKGIFLCVLFAVICANSLAKPSSDADEDNDEVERYVRGWASKIGQTLGKIAKVGLQGLMQPKREAMLRSAEAQG
3. L03A000314 From 1 To 59 E-value: 0.00000000009 Score: 57.4
MYKQIFLCLIIAALCATIMAEASAFADADEDDDKRYVRGMASKAGAIAGKIAKVALKAL
4. L01A000166 From 1 To 25 E-value: 0.000000006 Score: 51.2
GWASKIGQTLGKIAKVGLKELIQPK
5. L102709000 From 1 To 25 E-value: 0.00000003 Score: 49.3
GWASKIGQTLGKMAKVGLQELIQPK

Reference
[1] Yasuhara T.,Uchiyama M.,Tachibana S.,Araki K.,
Title:Isolation and structure of a new active peptide "Xenopsin" on the smooth muscle, especially on a strip of fundus from a rat stomach, from the skin of Xenopus laevis.
Journal:Chem. Pharm. Bull., 1973, 21, 2801-2804 [MEDLINE:74117770]
[2] Crippa M.,Sures I.,
Title:Xenopsin: the neurotensin-like octapeptide from Xenopus skin at the carboxyl terminus of its precursor.
Journal:Proc. Natl. Acad. Sci. U.S.A., 1984, 81, 380-384 [MEDLINE:84119491]
[3] Moore C.H.,Giovannini M.G.,Williams D.H.,Terry A.S.,Poulter L.,
Title:Levitide, a neurohormone-like peptide from the skin of Xenopus laevis. Peptide and peptide precursor cDNA sequences.
Journal:J. Biol. Chem., 1988, 263, 3279-3283 [MEDLINE:88139402]
[4] Sures I.,Kreil G.,Kuchler K.,
Title:The genes for the frog skin peptides GLa, xenopsin, levitide and caerulein contain a homologous export exon encoding a signal sequence and part of an amphiphilic peptide.
Journal:Eur. J. Biochem., 1989, 179, 281-285 [MEDLINE:89137103]
[5] Turner K.,Tomassini N.,Brasseur M.M.,Bevins C.L.,Moore K.S.,
Title:Antimicrobial peptides in the stomach of Xenopus laevis.
Journal:J. Biol. Chem., 1991, 266, 19851-19857 [MEDLINE:92011794]