Record in detail


General Info

  • lamp_id:L03A000314
  • Name:PYLAA_XENLA
  • FullName:PYLa/PGLa A
  • Source:Xenopus laevis
  • Mass:6808.9 Da
  • Sequence Length:64 aa
  • Isoelectric Point:8.75
  • Activity:Antimicrobial
  • Sequence
        MYKQIFLCLIIAALCATIMAEASAFADADEDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS
  • Function:PGLa and PGLa-H display a broad-spectrum of antibacterial activity against a range of Gram-positive and Gram-negative bacteria. PGLa also displays antifungal activity against C.albicans ATCC 14053. PGLa-H shows moderate antibacterial activity against the multidrug-resistant methicillin-resistant S. aureus (MRSA) but exhibits very little hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000314    From 1 To 64 E-value: 8e-31 Score: 124
        MYKQIFLCLIIAALCATIMAEASAFADADEDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS
  • 2. L03A000313    From 1 To 59 E-value: 0.00000000000001 Score: 70.5
        MYKGIFLCVLLAVICANSLATPSSDADEDNDEVERYVRGWASKIGQTLGKIAKVGLKEL
  • 3. L03A000312    From 1 To 59 E-value: 0.00000000000002 Score: 69.3
        MYKGIFLCVLFAVICANSLAKPSSDADEDNDEVERYVRGWASKIGQTLGKIAKVGLQGL
  • 4. L13A024362    From 1 To 24 E-value: 0.0000003 Score: 45.4
        YVRGMASKAGAIAGKIAKVALKAL
  • 5. L11A008259    From 1 To 22 E-value: 0.00002 Score: 39.7
        GMASKAGAIAGKIAKVALKALG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kreil G.,Richter K.,Hoffmann W.,
  •   Title:A novel peptide designated PYLa and its precursor as predicted from cloned mRNA of Xenopus laevis skin.
  •   Journal:EMBO J., 1983, 2, 711-714  [MEDLINE:84057748]
  •   [2]  Williams D.H.,Gibson B.W.,Poulter L.,Giovannini M.G.,
  •   Title:Biosynthesis and degradation of peptides derived from Xenopus laevis prohormones.
  •   Journal:Biochem. J., 1987, 243, 113-120  [PubMed:3606567]
  •   [3]  Sures I.,Kreil G.,Kuchler K.,
  •   Title:The genes for the frog skin peptides GLa, xenopsin, levitide and caerulein contain a homologous export exon encoding a signal sequence and part of an amphiphilic peptide.
  •   Journal:Eur. J. Biochem., 1989, 179, 281-285  [MEDLINE:89137103]
  •   [4]  Turner K.,Tomassini N.,Brasseur M.M.,Bevins C.L.,Moore K.S.,
  •   Title:Antimicrobial peptides in the stomach of Xenopus laevis.
  •   Journal:J. Biol. Chem., 1991, 266, 19851-19857  [MEDLINE:92011794]
  •   [5]  Liu L.,Xu J.,Pan P.,Li J.,Hou F.,
  •   Title:Isolation and characterisation of a new antimicrobial peptide from the skin of Xenopus laevis.
  •   Journal:Int. J. Antimicrob. Agents, 2011, 38, 510-515  [PubMed:22014884]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: