Record in detail


General Info

  • lamp_id:L03A000315
  • Name:DEF1_CLITE
  • FullName:Defensin-like protein 1
  • Source:Clitoria ternatea
  • Mass:5727.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:7.99
  • Activity:Antimicrobial
  • Sequence
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGINWKCFCYFDC
  • Function:Possesses antimicrobial activity sensitive to inorganic cations. Binds specifically to the fungal plasma membrane. Has no inhibitory effect on insect gut alpha-amylase.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  Q7M1F2
  •   2  Database:AMD  PDEF1_CLITE

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000315    From 1 To 50 E-value: 5e-25 Score: 104
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGINWKCFCYFDC
  • 2. L02A000004    From 1 To 49 E-value: 6e-23 Score: 97.8
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRG-NWKCFCYFDC
  • 3. L01A002972    From 1 To 49 E-value: 2e-22 Score: 96.3
        NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRG-NWKCFCYFNC
  • 4. L13A021221    From 2 To 48 E-value: 1e-16 Score: 76.6
        ERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC
  • 5. L01A002044    From 4 To 50 E-value: 2e-16 Score: 76.3
        ERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Torrekens S.,Goderis I.,Thevissen K.,De Samblanx G.W.,Osborn R.W.,
  •   Title:Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.
  •   Journal:FEBS Lett., 1995, 368, 257-262  [MEDLINE:95354848]
  •   [2]  Broekaert W.F.,Acland D.P.,Osborn R.W.,Thevissen K.,
  •   Title:Specific binding sites for an antifungal plant defensin from Dahlia (Dahlia merckii) on fungal cells are required for antifungal activity.
  •   Journal:Mol. Plant Microbe Interact., 2000, 13, 54-61  [PubMed:10656585]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: