Record in detail


General Info

  • lamp_id:L03A000330
  • Name:DEF1_SORBI
  • FullName:Defensin-like protein 1
  • Source:Sorghum bicolor
  • Mass:5382.2 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.21
  • Activity:Antimicrobial
  • Sequence
        RVCMGKSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC
  • Function:Belongs to the DEFL family. Protease inhibitor I18 (RTI/MTI-2) subfamily.

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  1925
  •   2  Database:DRAMP  DRAMP00284
  •   3  Database:Uniprot  P21923
  •   4  Database:AMD  PDEF1_SORBI

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000330    From 1 To 47 E-value: 2e-23 Score: 99.8
        RVCMGKSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC
  • 2. L06AT00034    From 1 To 47 E-value: 3e-23 Score: 99
        RVCMGKSQHHSFPCISDRLCSNECVKEDGGWTAGYCHLRYCRCQKAC
  • 3. L02A001528    From 1 To 47 E-value: 4e-22 Score: 95.1
        RVCMKGSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC
  • 4. L03A000329    From 1 To 47 E-value: 0.0003 Score: 35.8
        RVCMGKSAGFKGLCMRDQNCAQVCLQE--GWGGGNCDGVMRQCKCIRQC
  • 5. L02A000721    From 1 To 47 E-value: 0.001 Score: 33.9
        RICRRRSAGFKGPCVSNKNCAQVCMQE--GWGGGNCDGPLRRCKCMRRC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Richardson M.,Bloch C. Jr.,
  •   Title:A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or sorghum (Sorghum bicolar (L) Moench) have sequence homologies with wheat gamma-purothionins.
  •   Journal:FEBS Lett., 1991, 279, 101-104  [MEDLINE:91138737]
  •   [2]  Marino G.,Morhy L.,Bloch C. Jr.,Orru S.,Nitti G.,
  •   Title:Amino acid sequence and disulphide-bridge pattern of three gamma-thionins from Sorghum bicolor.
  •   Journal:Eur. J. Biochem., 1995, 228, 250-256  [MEDLINE:95220349]
  •   [3]  Carr M.D.,Zvelebil M.J.,Baud F.,Patel S.U.,Bloch C. Jr.,
  •   Title:1H NMR structure of an antifungal gamma-thionin protein SIalpha1: similarity to scorpion toxins.
  •   Journal:Proteins, 1998, 32, 334-349  [PubMed:9715910]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: