Record in detail


General Info

  • lamp_id:L03A000337
  • Name:CIRB_CHAPA
  • FullName:Circulin-B
  • Source:Chassalia parviflora
  • Mass:3307.9 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        SCVFIPCISTLLGCSCKNKVCYRNGVIPCGE
  • Function:Probably participates in a plant defense mechanism. Has antibiotic activity. Inhibits the cytopathic effects and replication of the human immunodeficiency virus. Active against both Gram-positive and Gram-negative bacteria.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P56879
  •   2  Database:AMD  CIRB_CHAPA

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000337    From 1 To 31 E-value: 0.000000000001 Score: 63.5
        SCVFIPCISTLLGCSCKNKVCYRNGVIPCGE
  • 2. L02A001022    From 1 To 31 E-value: 0.00000000002 Score: 59.3
        SCVFIPCISAAIGCSCKNKVCYRNGVIPCGE
  • 3. L02A000275    From 4 To 31 E-value: 0.00000000009 Score: 57.4
        SCVFIPCISTLLGCSCKNKVCYRNGVIP
  • 4. L03A000339    From 1 To 30 E-value: 0.000000002 Score: 53.1
        SCVWIPCISAALGCSCKNKVCYRNG-IPCGE
  • 5. L02A001024    From 1 To 30 E-value: 0.000000002 Score: 53.1
        SCVFIPCLTTVAGCSCKNKVCYRNG-IPCGE

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Suzuki T.,Suketa Y.,Hayashi K.,
  •   Title:Chemical structure of circulin B.
  •   Journal:Experientia, 1968, 24, 656-657  [MEDLINE:69089464]
  •   [2]  Kashman Y.,Parson I.C.,Henderson L.E.,Sowder R.C. II,Gustafson K.R.,
  •   Title:Circulins A and B: novel HIV-inhibitor macrocyclic peptide from tropical tree Chassalia parvifolia.
  •   Journal:J. Am. Chem. Soc., 1994, 116, 9337-9338  [DOI:10.1021/ja00099a064]
  •   [3]  Pannell L.K.,Gustafson K.R.,Derua R.,
  •   Title:Analysis of the disulfide linkage pattern in circulin A and B, HIV-inhibitory macrocyclic peptides.
  •   Journal:Biochem. Biophys. Res. Commun., 1996, 228, 632-638  [MEDLINE:97079229]
  •   [4]  Chiu K.-W.,Yang J.-L.,Lu Y.-A.,Tam J.P.,
  •   Title:An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1999, 96, 8913-8918  [MEDLINE:99362685]
  •   [5]  Craik D.J.,Gustafson K.R.,Daly N.L.,Koltay A.,
  •   Title:Structure of circulin B and implications for antimicrobial activity of the cyclotides.
  •   Journal:Int. J. Pept. Protein Res., 2005, 11, 99-106  [:]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: