Record in detail


General Info

  • lamp_id:L03A000339
  • Name:CIRA_CHAPA
  • FullName:Circulin-A
  • Source:Chassalia parviflora
  • Mass:3175.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial
  • Sequence
        SCVWIPCISAALGCSCKNKVCYRNGIPCGE
  • Function:Probably participates in a plant defense mechanism. Has antibiotic activity. Inhibits the cytopathic effects and replication of the human immunodeficiency virus. Active against the Gram-positive S.aureus with a minimum inhibition concentration of approximately 0.2 microM. Relatively ineffective against Gram-negative bacteria such as E.coli and P.aeruginosa.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P56871
  •   2  Database:AMD  CIRA_CHAPA

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000339    From 1 To 30 E-value: 0.000000000003 Score: 62.4
        SCVWIPCISAALGCSCKNKVCYRNGIPCGE
  • 2. L02A001025    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        SCVFIPCISAAIGCSCKNKVCYRNGFPCGE
  • 3. L13A027860    From 4 To 30 E-value: 0.0000000002 Score: 56.2
        SCVWIPCISAALGCSCKNKVCYRNGIP
  • 4. L02A001022    From 1 To 31 E-value: 0.0000000004 Score: 55.1
        SCVFIPCISAAIGCSCKNKVCYRNGVIPCGE
  • 5. L02A001024    From 1 To 30 E-value: 0.0000000007 Score: 54.3
        SCVFIPCLTTVAGCSCKNKVCYRNGIPCGE

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Suzuki T.,Hayashi K.,Suketa Y.,Fujikawa K.,
  •   Title:Chemical structure of circulin A.
  •   Journal:Experientia, 1965, 21, 307-308  [MEDLINE:67017287]
  •   [2]  Kashman Y.,Parson I.C.,Henderson L.E.,Sowder R.C. II,Gustafson K.R.,
  •   Title:Circulins A and B: novel HIV-inhibitor macrocyclic peptide from tropical tree Chassalia parvifolia.
  •   Journal:J. Am. Chem. Soc., 1994, 116, 9337-9338  [DOI:10.1021/ja00099a064]
  •   [3]  Pannell L.K.,Gustafson K.R.,Derua R.,
  •   Title:Analysis of the disulfide linkage pattern in circulin A and B, HIV-inhibitory macrocyclic peptides.
  •   Journal:Biochem. Biophys. Res. Commun., 1996, 228, 632-638  [MEDLINE:97079229]
  •   [4]  Chiu K.-W.,Yang J.-L.,Lu Y.-A.,Tam J.P.,
  •   Title:An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1999, 96, 8913-8918  [MEDLINE:99362685]
  •   [5]  Casas-Finet J.R.,Boyd M.R.,Gustafson K.R.,Koltay A.,Daly N.L.,
  •   Title:Solution structure by NMR of circulin A: a macrocyclic knotted peptide having anti-HIV activity.
  •   Journal:J. Mol. Biol., 1999, 285, 333-345  [MEDLINE:99096927]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: