Record in detail


General Info

  • lamp_id:L03A000352
  • Name:TAC2_TACTR
  • FullName:Tachyplesin-2
  • Source:Tachypleus tridentatus
  • Mass:9497.8 Da
  • Sequence Length:78 aa
  • Isoelectric Point:4.9
  • Activity:Antimicrobial
  • Sequence
        YMKKLVIALCLMMVLAVMVEEAEARWCFRVCYRGICYRKCRGKRNEVRQYRDRGYDVRAIPDETFFTRQDEDEDDDEE
  • Function:Significantly inhibits the growth of Gram-negative and Gram-positive bacteria.

Cross-Linking

  •   Cross-linking
  •   1  Database:Uniprot  P14214
  •   2  Database:AMD  TAC2_TACTR

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000352    From 1 To 78 E-value: 3.00004e-41 Score: 158
        YMKKLVIALCLMMVLAVMVEEAEARWCFRVCYRGICYRKCRGKRNEVRQYRDRGYDVRAIPDETFFTRQDEDEDDDEE
  • 2. L12A07972|    From 1 To 77 E-value: 9.99995e-41 Score: 156
        MKKLVIALCLMMVLAVMVEEAEARWCFRVCYRGICYRKCRGKRNEVRQYRDRGYDVRAIPDETFFTRQDEDEDDDEE
  • 3. L03A000153    From 1 To 68 E-value: 2e-34 Score: 135
        MKKLVIALCLMMVLAVMVEEAEAKWCFRVCYRGICYRRCRGKRNEVRQYRDRGYDVRAIPEETFFTRQ
  • 4. L01A000145    From 1 To 17 E-value: 0.00002 Score: 39.7
        RWCFRVCYRGICYRKCR
  • 5. L01A000146    From 1 To 17 E-value: 0.00003 Score: 38.9
        KWCFRVCYRGICYRKCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Iwanaga S.,Yoshikawa K.,Yonega T.,Tokunaga F.,Miyata T.,
  •   Title:Antimicrobial peptides, isolated from horseshoe crab hemocytes, tachyplesin II, and polyphemusins I and II: chemical structures and biological activity.
  •   Journal:J. Biochem., 1989, 106, 663-668  [MEDLINE:90110066]
  •   [2]  Iwanaga S.,Tokunaga F.,Toh Y.,Muta T.,Shigenaga T.,
  •   Title:Antimicrobial tachyplesin peptide precursor. cDNA cloning and cellular localization in the horseshoe crab (Tachypleus tridentatus).
  •   Journal:J. Biol. Chem., 1990, 265, 21350-21354  [MEDLINE:91065956]
  •   [3]  Muta T.,Seki N.,Kawasaki S.,Takayenoki Y.,Shigenaga T.,
  •   Title:Separation of large and small granules from horseshoe crab (Tachypleus tridentatus) hemocytes and characterization of their components.
  •   Journal:J. Biochem., 1993, 114, 307-316  [MEDLINE:94110249]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: