Record in detail
General Info
- lamp_id:L04ABAC041
- Name:LC70_LACPA
- FullName:Bacteriocin lactocin-705
- Source:Lactobacillus paracasei
- Mass:3357.9 Da
- Sequence Length:31 aa
- Isoelectric Point:10.58
- Activity:Antimicrobial
- Sequence
GMSGYIQGIPDFLKGYLHGISAANKHKKGRL - Function:Antibacterial activity against several lactic acid bacteria, Listeria, Streptococci, etc.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ3891
- 2 Database:dbAMP dbAMP_03884
- 3 Database:DRAMP DRAMP00145
- 4 Database:SATPdb satpdb17586
- 5 Database:Uniprot P80959
- 6 Database:BAC BAC041
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A06640| From 22 To 52 E-value: 0.0000000000004 Score: 65.1
GMSGYIQGIPDFLKGYLHGISAANKHKKGRL - 2. L04ABAC041 From 1 To 31 E-value: 0.0000000000005 Score: 64.7
GMSGYIQGIPDFLKGYLHGISAANKHKKGRL - 3. L02A001175 From 1 To 31 E-value: 0.0000000000007 Score: 64.3
GMSGYIQGIPDFLKGYLHGISAANKHKKGRL - 4. L13A020576 From 1 To 30 E-value: 0.000000000002 Score: 63.2
GMSGYIQGIPDFLKGYLHGISAANKHKKGR - 5. L12A09086| From 19 To 35 E-value: 6 Score: 21.2
SGFTQGISDFASCHTNG
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Oliver G.,de Ruiz Holgado A.A.,de Kairuz M.N.,Fadda S.,Vignolo G.,
- Title:Control of Listeria monocytogenes in ground beef by "Lactocin 705", a bacteriocin produced by Lactobacillus casei CRL 705).
- Journal:Int. J. Food Microbiol., 1996, 29, 397-402 [MEDLINE:96389111]
Comments
- Comments
No comments found on LAMP database