Record in detail


General Info

  • lamp_id:L04ABAC089
  • Name:Q84HW0_LACPN
  • FullName:
  • Source:Lactobacillus plantarum
  • Mass:5553.4 Da
  • Sequence Length:47 aa
  • Isoelectric Point:10.19
  • Activity:Antimicrobial
  • Sequence
        MDKFEKISTSNLEKISGGDLTTKLWSSWGYYLGKKARWNLKHPYVQF
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L04ABAC089    From 1 To 47 E-value: 3e-23 Score: 98.6
        MDKFEKISTSNLEKISGGDLTTKLWSSWGYYLGKKARWNLKHPYVQF
  • 2. L02A001167    From 1 To 28 E-value: 0.000000000004 Score: 61.6
        LTTKLWSSWGYYLGKKARWNLKHPYVQF
  • 3. L12A08959|    From 1 To 42 E-value: 0.03 Score: 28.9
        MQNVKEVSVKEMKQIIGGS-NDSLWYGVGQFMGKQANCITNHP
  • 4. L12A09551|    From 13 To 51 E-value: 0.43 Score: 25.4
        VDAFAPISNNKLNGVVGGGAWKNFWSSLRKGFYDGEAGR
  • 5. L04ABAC103    From 4 To 37 E-value: 1 Score: 23.9
        LNKFSTLGKSSLSQIEGGSVPTSV-----YTLGIKILWS

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jimenez-Diaz R.,Ruiz-Barba J.L.,Maldonado A.,
  •   Title:Purification and genetic characterization of plantaricin NC8, a novel coculture-inducible two-peptide bacteriocin from Lactobacillus plantarum NC8.
  •   Journal:Appl. Environ. Microbiol., 2003, 69, 383-389  [MEDLINE:22401440]
  •   [2]  Ruiz-Barba J.L.,Jimenez-Diaz R.,Maldonado A.,
  •   Title:Induction of plantaricin production in Lactobacillus plantarum NC8 after coculture with specific gram-positive bacteria is mediated by an autoinduction mechanism.
  •   Journal:J. Bacteriol., 2004, 186, 1556-1564  [PubMed:14973042]
  •   [3]  Zarazaga M.,Diez L.,Saenz Y.,Rojo-Bezares B.,Navarro L.,
  •   Title:Comparative study of the pln locus of the quorum-sensing regulated bacteriocin-producing L. plantarum J51 strain.
  •   Journal:Int. J. Food Microbiol., 2008, 128, 390-394  [PubMed:18819721]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: