Record in detail


General Info

  • lamp_id:L04ABAC098
  • Name:SBOX_BACSU
  • FullName:Bacteriocin-like protein sboX
  • Source:Bacillus subtilis (strain 168)
  • Mass:5793.8 Da
  • Sequence Length:50 aa
  • Isoelectric Point:10.01
  • Activity:Antimicrobial
  • Sequence
        MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI
  • Function:In stationary phase of anaerobic cultures.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L04ABAC098    From 1 To 50 E-value: 3e-24 Score: 102
        MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI
  • 2. L11A004128    From 9 To 30 E-value: 8.7 Score: 20.8
        LYQGDNIPKAPSTAEHPFLPSI
  • 3. L11A004127    From 9 To 30 E-value: 8.7 Score: 20.8
        LYQGDNIPKAPSTAEHPFLPSI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Alloni G.,Albertini A.M.,Moszer I.,Ogasawara N.,Kunst F.,
  •   Title:The complete genome sequence of the Gram-positive bacterium Bacillus subtilis.
  •   Journal:Nature, 1997, 390, 249-256  [MEDLINE:98044033]
  •   [2]  Zuber P.,Hehn R.,Zheng G.,
  •   Title:Mutational analysis of the sbo-alb locus of Bacillus subtilis: identification of genes required for subtilosin production and immunity.
  •   Journal:J. Bacteriol., 2000, 182, 3266-3273  [MEDLINE:20270159]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: